KEGG   Mus musculus (mouse): 107515
Entry
107515            CDS       T01002                                 

Symbol
Lgr4, 9130225G07, A330106J01Rik, A930009A08Rik, Gpr, Gpr48
Name
(RefSeq) leucine-rich repeat-containing G protein-coupled receptor 4
  KO
K04309  leucine-rich repeat-containing G protein-coupled receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107515 (Lgr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    107515 (Lgr4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   R-spondin
    107515 (Lgr4)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 7tm_1 LRR_1 LRRNT LRR_6
Other DBs
NCBI-GeneID: 107515
NCBI-ProteinID: NP_766259
MGI: 1891468
Ensembl: ENSMUSG00000050199
Vega: OTTMUSG00000015138
UniProt: A2ARI4 Q8BZR7
Position
2; 2 E3
AA seq 951 aa
MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQ
ALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEF
PQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASLVQWFPNLAGTVHLESLTLTGTKISSIPDDLCQNQKMLRTLDLSYNDIRDLPS
FNGCRALEEISLQRNQISLIKETTFQGLTSLRILDLSRNLIREIHSGAFAKLGTITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFQLKDALAARDFANLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSPQDHSVTKEKGATDAANATSTAESEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALLFNLLVILTVFASCSSLPASKLFIGLISVSNLLMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGSLAVFSSESAVFLLTLAAVERSVFAKDVMKNGKSSHLR
QFQVAALVALLGAAIAGCFPLFHGGQYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAIIYTKLYCNLEKEDPSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKDDWKLLKRRVTRKHGSVSVSISSQGGCGEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPVLTVASCQRPEAYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVRD
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgccgggcccgctgcggctgctctgcttcttcgccctggggctgctcggctcggccggg
cccagcggcgcggcgccacctctctgcgctgcgccctgcagctgcgacggcgaccgtcgg
gtggactgctccgggaaggggttgacggcggtaccggaggggctcagcgccttcacccaa
gcactggatatcagtatgaacaatatcactcagttaccagaagatgcatttaagaatttt
ccttttctagaggagctacaactggctggtaacgacctttcttttatccacccaaaagcc
ttgtctgggttgaaagaactcaaagtcctaaccctccagaacaatcagttgaaaacagta
cccagtgaagccattcgtggactgagtgctttgcagtctctacgcttagatgccaaccat
attacctcagtcccggaggacagttttgaagggctcgttcagttgcggcatctgtggctg
gatgacaacatcttgacggaagtgcctgtgcgtccgctcagcaacctgccaaccctgcag
gcgctgaccttggctctcaacaacatctcaagcatccccgacttcgcattcaccaacctt
tcaagcttggtagtgctgcatcttcataacaataaaattaaaagcctcagtcaacactgt
tttgatggactagataacctggaaaccctggacttgaattataataacttggatgaattt
cctcaggctattaaagcccttcccagccttaaagagctgggatttcacagtaattctatt
tctgttatcccggatggagcatttgctggtaatccactgctaagaactatccatttgtat
gataatcctctgtcttttgtggggaactcagcatttcacaacctgtctgatctgcattcc
ttagtcattcgtggtgcaagcctggtgcagtggttccccaatctggccggaactgtccat
ctggagagtctaaccttgacagggacaaaaataagcagcatacctgatgatctgtgccaa
aaccaaaagatgctgcggactctggacttatcttataacgatataagagaccttccaagt
tttaatggttgtcgtgcattggaagaaatttcattgcagcgtaatcaaatctccctgata
aaggaaactacttttcaaggcctaacatccctaaggattctagatctgagtagaaacctg
attcgtgaaattcacagtggagcttttgcgaagcttgggacaattactaacctggatgtg
agtttcaatgaattaacctcatttcctacggaaggcctgaatgggctcaatcaacttaaa
cttgtgggtaacttccagctgaaagatgccttggcagccagagactttgccaatctcagg
tctctatcagtaccatatgcttatcagtgttgtgcattttgggggtgtgactcttatgca
aatttaaacacagaagataacagcccccaagaccacagtgtgacaaaagagaaaggtgct
acagatgcagcaaatgccaccagcactgctgaaagtgaagaacatagccaaataatcatc
cattgtacaccttcaacaggtgcttttaagccctgtgaatatttactgggaagctggatg
attcgccttacagtgtggttcattttcctggtcgccttgcttttcaacctgcttgtcatt
ttaacagtgtttgcgtcttgttcatcactgcctgcctccaagctcttcataggcttgatt
tctgtgtctaacttactcatgggcatctatactggcatccttacttttcttgatgctgtg
tcctggggccgatttgctgaatttggcatttggtgggaaactggcagcggctgcaaggta
gctgggtctctggcagtcttctcctcagagagcgccgtattcctgttaaccctggcagcc
gtggaaagaagcgtttttgcaaaggatgtaatgaaaaatgggaaaagcagtcacctccga
cagttccaggtggctgccctcgtagctttgctgggtgctgcaatagcaggctgcttcccc
ctttttcacggagggcaatattctgcatcacccttgtgcttgccatttcctacaggagag
acaccatcattaggattcactgtgaccctagtgctattaaactcactagcatttttattg
atggccattatctacactaaactctactgcaacttagagaaagaagacccgtcagaaaac
tcccagtctagcatgattaagcacgttgcttggctcatcttcacaaactgcatcttcttc
tgccctgttgcatttttctcattcgcaccattgatcacggcaatctccatcagccccgag
ataatgaagtctgttacgctgatattcttcccgctgcctgcttgcctgaatccagtcctg
tacgttttcttcaacccaaagtttaaagacgactggaagctcctgaagcggcgtgtcacc
aggaaacacggatcagtctcagtctccatcagcagccaaggcggttgtggggaacaggat
ttctactacgactgtggcatgtattcccacttgcagggtaacctgactgtctgtgactgc
tgtgagtcatttcttctgacaaaaccagtatcgtgcaaacacttaataaaatcgcacagt
tgtcctgtattgacagtggcctcttgccagaggccagaggcctactggtctgattgtggc
acacagtcggcccattctgactatgcagatgaagaggattcctttgtctcggacagctct
gaccaggtgcaggcctgtggacgagcctgcttctaccagagtcgcggattccctctggtg
cgctatgcttataatctaccgagagtcagagactga

DBGET integrated database retrieval system