KEGG   Mus musculus (mouse): 14228
Entry
14228             CDS       T01002                                 

Gene name
Fkbp4, AL022792, AW208983, FKBP-4, FKBP-52, FKBP52, FKPB52, p59
Definition
(RefSeq) FK506 binding protein 4
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    14228 (Fkbp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    14228 (Fkbp4)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     14228 (Fkbp4)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    14228 (Fkbp4)
SSDB
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_12 TPR_11 TPR_16 TPR_6 TPR_14 TPR_19 FKBP_N_2 TPR_7 TPR_9 PknG_TPR TPR_17 OmpH
Other DBs
NCBI-GeneID: 14228
NCBI-ProteinID: NP_034349
MGI: 95543
Ensembl: ENSMUSG00000030357
Vega: OTTMUSG00000024637
UniProt: P30416
Position
6; 6 F3
AA seq 458 aa
MTAEEMKAAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETPMIGDRVFVHYTGW
LLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGAAGSPP
KIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIRTRGEGYARPNDGAMVEVALEGYHKD
RLFDQRELCFEVGEGESLDLPCGLEEAIQRMEKGEHSIVYLKPSYAFGSVGKERFQIPPH
AELRYEVRLKSFEKAKESWEMSSAEKLEQSNIVKERGTAYFKEGKYKQALLQYKKIVSWL
EYESSFSGEEMQKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRG
EAHLAVNDFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERLAE
EEHKVKAEVAAGDHPTDAEMKGERNNVAENQSRVETEA
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaccgccgaggagatgaaggcggcggagaacggggcgcagtcggcgcccctgcctctc
gaaggagtggacatcagccccaaacaggacgagggcgtgctcaaggtcatcaagagagag
ggtacaggcacagagacacccatgatcggggaccgagtctttgtccactacactggctgg
ctgctagatggcacaaagtttgactccagtctggaccgcaaggacaaattctcctttgac
ctgggaaaaggggaggtcatcaaggcttgggatattgctgtggcaaccatgaaagtgggg
gaagtgtgccacatcacctgcaagccagaatatgcctatggcgcagcaggcagccctccg
aagatcccccccaacgccacacttgtatttgaggtggagctgtttgagttcaaaggagaa
gatcttacagaagaagaagatggcgggatcatccgcagaatacggactcggggtgaaggc
tatgccaggcccaatgatggtgctatggtggaagtggccctggaaggctaccacaaggac
cgcctctttgaccagcgggagctctgctttgaagtcggggaaggggaaagtctagatctg
ccctgtgggctggaggaggccattcagcgcatggagaaaggagagcattccatcgtgtac
ctcaaacctagctatgcttttggcagtgtggggaaggagaggttccagatcccaccgcac
gctgagctgaggtatgaagtgcggctgaagagctttgagaaggccaaggagtcttgggag
atgagctccgcggagaagctggagcagagcaacatagtgaaagagaggggcaccgcgtac
ttcaaggaaggcaagtacaagcaggcgttactgcagtacaagaagatcgtgtcttggcta
gaatacgagtctagcttctccggtgaggaaatgcaaaaggtccatgcactccgactggcc
tcacacctcaatctggccatgtgtcacctgaaactgcaggccttctcagctgccatcgaa
agctgcaacaaggccttggagctggacagcaacaacgagaagggcctgtttcgccgggga
gaggcccacctggccgtgaatgactttgacctggcaagagctgacttccaaaaggtcctg
cagctctatcccagcaacaaagccgccaagacccagctggctgtgtgccagcagcggacc
cgtaggcagctcgcccgggaaaagaagctctatgccaacatgtttgagaggctggctgag
gaggagcacaaggtgaaggcagaagtggcagcaggagaccatcccactgatgctgagatg
aagggtgagcggaacaatgtggccgagaaccagtctcgggtggagacagaagcgtag

DBGET integrated database retrieval system