KEGG   Mus musculus (mouse): 18453
Entry
18453             CDS       T01002                                 

Gene name
P4hb, ERp59, PDI, Pdia1, Thbp
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18453 (P4hb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18453 (P4hb)
   04131 Membrane trafficking [BR:mmu04131]
    18453 (P4hb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18453 (P4hb)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     18453 (P4hb)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   18453 (P4hb)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    18453 (P4hb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   18453 (P4hb)
  Exosomal proteins of colorectal cancer cells
   18453 (P4hb)
  Exosomal proteins of bladder cancer cells
   18453 (P4hb)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_7 ERp29_N AhpC-TSA Thioredoxin_8 Redoxin Thioredoxin_3 HyaE
Other DBs
NCBI-GeneID: 18453
NCBI-ProteinID: NP_035162
MGI: 97464
Ensembl: ENSMUSG00000025130
Vega: OTTMUSG00000004095
UniProt: P09103
Position
11 E2; 11 84.27 cM
AA seq 509 aa
MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEA
IDDIPFGITSNSGVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
EVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDEDLDLEEALEPDMEEDDDQKAVKDEL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctgagccgtgctttgctgtgcctagccctggcctgggcggctagggtgggcgccgac
gccctggaggaggaggacaacgtcctggtgttgaagaagagcaacttcgaggaggcgctg
gcggcgcacaagtacctgctggtggagttctatgccccgtggtgtggccactgcaaagct
ctggctcccgagtatgccaaagctgccgcaaaactgaaggcagaaggctctgagattcga
ctagcaaaggtggatgccacagaagagtctgacctggctcagcagtatggtgtccgtggc
taccccacaatcaagttcttcaagaatggagacacagcctccccaaaggaatatacagct
ggcagggaagctgatgacattgtcaactggctgaagaaacgcacgggcccagcagctaca
accctgtctgacactgcagctgcagagtccttggtggactcaagcgaagtgacggtcatc
ggtttcttcaaggacgtagagtcagactctgccaagcagttcttgctggcagcagaggct
attgatgacataccttttggaatcacgtccaacagtggtgtgttctccaagtaccagctg
gacaaagatggggtggtcctctttaagaagtttgatgaaggccgcaacaactttgagggt
gagatcaccaaggagaagcttctagacttcatcaagcacaatcagctgcctttggtcatc
gagttcactgaacagacagctccgaagatttttggaggtgagatcaagacacacattctg
ctgttcctgcccaagagtgtatctgactatgacggcaagctgagcagcttcaagagagca
gccgagggcttcaagggcaagatcctatttatcttcatcgatagcgaccacactgataac
cagcgcatacttgagttctttggcctgaagaaggaggagtgtcccgctgtgcggcttatt
accctagaggaagagatgaccaagtacaaaccagagtcagatgagctgacggctgagaaa
atcacagagttttgccaccgcttcttagagggcaagatcaagccccacctgatgagccaa
gaagtgcctgaagactgggacaaacagccggtaaaagtactggttggggcgaactttgaa
gaggtcgcttttgatgagaaaaagaacgtgtttgttgaattctatgccccttggtgtggt
cactgcaagcagctagcccccatttgggataaactgggagagacatacaaggatcatgag
aatatcatcattgctaagatggactcaacagccaatgaggtggaagctgtcaaagtacat
agctttcccacactgaagttcttcccagcaagtgcagacagaacggtcattgattacaac
ggcgagcggacactggacggttttaagaaattcttggagagtggtggccaggatggagca
ggggacgatgaggacctcgacctagaagaagctttagagccagacatggaggaagacgac
gatcagaaagctgtgaaggatgaactgtag

DBGET integrated database retrieval system