KEGG   Mus musculus (mouse): 215114
Entry
215114            CDS       T01002                                 

Gene name
Hip1, 2610109B09Rik, A930014B11Rik, E130315I21Rik, mKIAA4113
Definition
(RefSeq) huntingtin interacting protein 1
  KO
K04559  huntingtin interacting protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    215114 (Hip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    215114 (Hip1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    215114 (Hip1)
SSDB
Motif
Pfam: ANTH I_LWEQ HIP1_clath_bdg TACC_C PTH2
Other DBs
NCBI-GeneID: 215114
NCBI-ProteinID: NP_666113
MGI: 1099804
Ensembl: ENSMUSG00000039959
Vega: OTTMUSG00000055920
UniProt: Q8VD75
Position
5 G2; 5 75.18 cM
AA seq 1029 aa
MDRMASSMKQVSNPLPKVLSRRGVGAGMEAAERESFERTQTVSVNKAINTQEVAVKEKHA
RTCILGTHHEKGAQTFWSVVNRLPLSSNAMLCWKFCHVFHKLLRDGHPNVLKDSLRYKNE
LSDMSRMWGHLSEGYGQLCSIYLKLLRTRMEYHTKNPRFPGNLQMSDRQLDEAGESDVNN
FFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTTAGQCRLAPLIQVILDCSHLYDYTV
KLLFKLHSCLPADTLQGHRDRFMEQFTKLKDLFQRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAEVSSPDSEPVLEKDDLMDMDASQQTLFDNKFDDVFGSSLSSDPF
NFNNQNGVNKDEKDHLIERLYREISGLTGQLDNMKIESQRAMLQLKGRVSELEAELAEQQ
HLGRQAMDDCEFLRTELDELKRQREDTEKAQRSLTEIERKAQANEQRYSKLKEKYSELVQ
NHADLLRKNAEVTKQVSVARQAQVDLEREKKELADSFARTQEQQDVLENLKHELATSRQE
LQVLHSNLETSAQSEAKWLTQIAELEKEQGSLATVAAQREEELSALRDQLESTQIKLAGA
QESMCQQVKDQRKTLLAGIRKAAEREIQEALSQLEEPTLISCAGSTDHLLSKVSSVSSCL
EQLEKNGSQYLACPEDISELLHSITLLAHLTGDTIIQGSATSLRAPPEPADSLTEACRQY
GRETLAYLSSLEEEGTMENADVTALRNCLSRVKTLGEELLPRGLDIKQEELGDLVDKEMA
ATSAAIEAATTRIEEILSKSRAGDTGVKLEVNERILGSCTSLMQAIKVLVVASKDLQKEI
VESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATIMVDAADLVVQGKGKFEELMVCSR
EIAASTAQLVAASKVKANKGSLNLTQLQQASRGVNQATAAVVASTISGKSQIEETDSMDF
SSMTLTQIKRQEMDSQVRVLELENDLQKERQKLGELRKKHYELAGVAEGWEEGTEASPST
VQEAIPDKE
NT seq 3090 nt   +upstreamnt  +downstreamnt
atggaccgaatggccagctccatgaagcaggtatccaacccgctgcccaaagtgttgagc
cgccgcggagttggtgctgggatggaggctgcggagcgcgagagcttcgagcggactcag
acggtcagcgtcaataaggccattaatacgcaggaagtggccgtgaaagagaaacatgcc
aggacgtgtattctgggcacccaccatgagaaaggagcgcagaccttttggtctgtggtc
aaccgactgcctctctccagcaacgccatgctgtgctggaagttttgtcacgtgttccac
aaacttcttcgagatggacatccgaacgtgctgaaagactctctgagatacaaaaatgag
ttaagcgacatgagcaggatgtggggccacctgagcgaggggtatggacagctttgcagc
atctacctcaaactgctgagaacaaggatggagtaccacaccaaaaatcccaggttcccg
ggcaacctccagatgagtgaccgacagctggatgaggccggagaaagtgacgttaacaac
ttttttcagctcacagtggagatgtttgattacctggagtgtgaactgaacctcttccag
actgtgttcaactccttggacatgtcccgttcggtgtccgtgaccacggctggccagtgc
cgcctcgcaccgctcatccaggtcatcctggactgcagtcacctctatgactacactgtc
aagctgctcttcaagctccactcctgtcttccagctgacaccctgcagggccaccgagac
cgcttcatggagcagttcacaaagttgaaagatctgtttcagcgctccagcaacctacag
tacttcaagcggctcattcagatcccccagctgcccgagaatccacccaacttcctacga
gcctcggccctgtcagagcacatcagtcctgtggtggtgatcccggcagaggtgtcatcc
ccagacagtgagcctgtcctggagaaggatgacctcatggacatggacgcctcccagcag
actttgtttgacaacaagtttgatgacgtctttggcagctcattgagcagcgaccctttc
aatttcaacaatcaaaatggcgtgaacaaggacgagaaggaccacttgattgaacgcctg
tacagagagatcagtggactgacagggcagctggacaacatgaagattgagagccagcgg
gccatgctgcagctgaagggtcgagtgagtgagctggaggcagagctagcagagcagcag
cacttgggccggcaggctatggatgactgcgagttcctgcgcactgagctggatgaactg
aagaggcagcgagaggacacggagaaggcacagcgcagcctgactgagatagaaagaaag
gcccaggctaatgaacagaggtatagcaagttaaaagagaagtacagtgaactggtgcag
aaccatgctgacctgctgcggaagaacgcagaggtgaccaaacaggtgtccgtggcccgg
caagcccaggtggatttggaaagagagaaaaaagagctagcagattcctttgcacggact
caagagcaacaggatgttctagagaacctgaagcatgaactggccaccagcagacaggag
ctgcaggtcctccacagcaacctggaaacctctgcccagtcagaagcgaaatggctgaca
cagatcgccgagttggagaaggaacaaggcagcttggcgactgttgcagctcagagagag
gaagagttatcagccctccgagaccagctggaaagcacccagatcaagctggctggggcc
caggaatccatgtgccagcaggtgaaggaccagaggaaaaccctcttggcagggatcagg
aaggctgcggagcgtgagatacaggaggcgctgagccagcttgaggaacccaccctcatc
agctgtgcaggatccacagatcaccttctctccaaagtcagctccgtttccagctgcctc
gagcaactggaaaagaacggcagccagtatctggcctgcccagaagatattagtgagctt
ctgcactcgatcaccctgcttgcccacttgaccggtgacactatcatccaggggagtgcc
accagcctccgggccccaccggagccagccgactcgctgacggaggcctgtaggcagtat
ggcagagaaaccctggcctatctgtcctccctggaggaagagggaactatggagaatgct
gacgtcacagcccttaggaactgcctcagcagggtcaagacccttggcgaggagctgctg
cccaggggcctggacatcaagcaggaagagctgggtgacctggtggacaaggagatggca
gccacttcagctgccattgaagctgccaccacccggatagaggaaattctcagtaagtcc
cgagcaggagacacgggagtcaagctggaggtgaatgagaggatcctgggttcctgtacc
agcctgatgcaggccatcaaggtgctcgttgtggcctccaaggacctccagaaggagata
gtggagagtggcaggggtactgcatcccctaaagaattttacgccaagaactctcggtgg
acggaagggctgatatccgcctccaaagctgttggttggggagctaccatcatggtggat
gctgctgatcttgtggtccaaggcaaagggaagttcgaggagctgatggtgtgttcacgc
gagattgctgccagtactgcccagctcgtggctgcatccaaggtgaaagcgaacaagggc
agcctcaatctgacccagctgcagcaggcctctcgaggagtgaaccaggccacagccgct
gtggtggcctcaaccatttctggcaaatctcagattgaggaaacagacagtatggacttc
tcaagcatgacactgacccagatcaagcgccaggagatggattcccaggttagggtgctg
gagctggaaaatgacctgcagaaggagcgtcagaaactaggagagctacggaagaaacac
tacgagctggcgggcgtggctgagggctgggaggaagggacagaagcatcaccgtctact
gtccaagaagcaataccggacaaagagtag

DBGET integrated database retrieval system