KEGG   Mus musculus (mouse): 22654
Entry
22654             CDS       T01002                                 

Gene name
Zfp13, AI835008, Krox-8, Zfp-13
Definition
(RefSeq) zinc finger protein 13
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22654 (Zfp13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22654 (Zfp13)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22654 (Zfp13)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz Zn-ribbon_8 zf_UBZ zf-C2H2_6 zf-Di19 zf-met Zn_ribbon_SprT C1_4 zf-LYAR OSTMP1 Zn-C2H2_12
Other DBs
NCBI-GeneID: 22654
NCBI-ProteinID: NP_035877
MGI: 99159
Ensembl: ENSMUSG00000062012
UniProt: P10754
Position
17; 17 A3.3
AA seq 505 aa
MSADSQSIAATENEEKSHEVPGNVQHCGDMLSGQEETVPLGTSQESTHIKAEPEEPHSEG
ASREDRTPGTQRWMSPCPGPKDKVVPSPWTPVLSRGGRTRERKMAAALLTAWSQMPVTFE
DVALYLSQEEWGRLDHTQQNFYRDVLQGKNGLALGAVEMGKVVPALAVATLEDTKSIRTR
ARWAPGEDPKCGQHVASGPGTKLTRDTGKAGQLKPAPSESRPLKTPEDSGPEKPSEGEEA
LKSGEEGLVPDGDTGKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYTCTDCGKRFGRSS
HLIQHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVT
HQGTHTGAKPHKCPICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRT
HTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTG
PKALAMLMLGAAAAGALTAPPPAST
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtctgcagacagtcaaagcatcgcggctactgagaacgaggagaaatcccatgaggtc
ccaggtaatgtgcaacactgtggagacatgctctctggacaggaggagacagtgcccttg
ggaacctctcaggagtcaacacacatcaaggcagagccagaagagccacacagtgagggg
gcatcacgggaggacaggactccaggaacacagcgctggatgtccccgtgtcctggccct
aaggacaaagttgttccttctccctggactcctgtactgtcccgagggggacggaccaga
gagcgaaagatggctgctgcactccttactgcctggtcccagatgccggtgacctttgag
gatgtggccctgtatctctcccaggaggagtggggaaggctggaccacacacagcaaaat
ttctacagagatgtactacaggggaaaaacgggctggctttgggagccgtggaaatgggg
aaggtggttccagccttggccgtcgcaaccctagaggacacaaaatcgataaggactagg
gccaggtgggccccgggggaagacccaaagtgtggtcagcacgtggctagtggcccaggt
acaaagctgaccagagacactgggaaagctggtcagctaaagccagccccatctgaatca
cgtcctctcaagaccccagaggacagcggcccagagaaacccagtgagggggaggaggct
ctgaaaagtggcgaagagggtctggtacccgacggtgacacgggcaagaagacatacaag
tgcgagcagtgtggcaagggcttcagttggcactcgcacctggtgacacaccggcgtacg
cacacgggcgagaagccttatacctgcacggactgtggcaagcgcttcggccgcagctca
cacctcatccagcaccagatcatccacacgggcgagaagccctatacctgcccctcgtgt
tggaagagcttcagccaccactccacgctgatccagcaccagcgcatccacactggtgag
aagccctacgtgtgcgaccgctgtgccaagcgcttcacccgtcgctcggacctagtcaca
caccagggcactcacaccggcgccaagccccacaagtgccccatctgcagcaagtgcttc
acccagagctccgccctggtcacgcaccagcgcacccacaccggcgtcaagccctacccg
tgcccggagtgcggcaagtgcttcagccagcgctccaatctcatcgcacataatcgcacc
cacacgggcgagaagccctaccactgcctcgactgtggcaagagcttcagccacagctcg
cacctcactgcccaccaacgcactcaccgtggcgtgaggccctactcctgcccactttgc
ggcaagagcttcagccgccgctccaacctgcaccggcacgagaagatccacaccactgga
cccaaggctctggccatgctcatgctgggggcggcagctgcgggggcgctcacggcacca
ccacctgcttccacttag

DBGET integrated database retrieval system