KEGG   Mus musculus (mouse): 270156
Entry
270156            CDS       T01002                                 

Gene name
Nkapd1, AU01982, AU019823, Gm639
Definition
(RefSeq) NKAP domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: NKAP
Other DBs
NCBI-GeneID: 270156
NCBI-ProteinID: NP_001128374
MGI: 2143205
Ensembl: ENSMUSG00000059820
Vega: OTTMUSG00000033528
UniProt: E9PUQ3 Q6NX79
Position
9; 9 A5.3
AA seq 292 aa
MSRVPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYQGTRRNTVPSSSSRMR
SDGFDEESQRDYWRSKNEISGALEDDFLKTKSWNKKLYDYESNIPDRWGHSGYKELYPEE
FETDSSDQQDITNGKKPSPQVKSSARESRKHKKSKKSHKKKQKKRSHKKQKKNKKEVTDI
TADSSSEFSEETRASSTRKRKQPHKSKKKSRKKSPKITFPLGGESGTSQSEDSASSSSED
IEERDTKKTKRKKKEKSVHVPMPDPEVQERTSKRRNWKVATDARSAESSEDD
NT seq 879 nt   +upstreamnt  +downstreamnt
atgtcccgggttccgttggggaaagtcctcttgaggaatgtcatccggcacacagatgct
cacaataagattcaggaggagtctgacatgtggaaaatcagagaactagagaagcagatg
gaggatgcttaccaggggaccagaaggaacacagtgcccagcagctcaagtcggatgaga
agtgatggttttgatgaagaaagtcagagagattactggaggtcaaagaatgaaatttct
ggggccttggaagatgattttcttaagactaagtcctggaacaagaagttatatgattat
gaatccaatataccagacagatggggtcacagtggttataaagagttgtatcctgaagag
tttgaaacagacagtagtgatcagcaagacattaccaatggaaaaaaaccatctccccag
gtaaaatcatctgcccgtgaatctcgaaaacataagaagtcaaagaaatcccataagaag
aagcagaaaaaacggtcacacaaaaaacagaagaaaaacaaaaaggaagttacggacata
acagcagattcctcaagtgagttctcagaggaaactcgagcttctagtactaggaaaagg
aagcaaccacacaagagcaagaaaaagtccaggaaaaagtctcctaaaatcactttccct
ttagggggagaaagtggtacttctcagtcagaggattctgcatctagcagttctgaggac
atcgaggaaagagatactaagaaaaccaaacggaaaaagaaagagaagagtgtccatgtc
cccatgcctgaccctgaggtacaggagaggacaagcaagcgcaggaactggaaggtggct
accgacgccaggtctgctgagagctcggaggatgactaa

DBGET integrated database retrieval system