KEGG   Mus musculus (house mouse): 433804
Entry
433804            CDS       T01002                                 
Symbol
Zfp985, Gm13154
Name
(RefSeq) zinc finger protein 985
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    433804 (Zfp985)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    433804 (Zfp985)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    433804 (Zfp985)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_11 zf-C2H2_4 zf-met
Other DBs
NCBI-GeneID: 433804
NCBI-ProteinID: NP_001014419
MGI: 3651986
Ensembl: ENSMUSG00000065999
UniProt: A2A7A5 Q5U4F7
Position
4:147637734..147669658
AA seq 519 aa
MSESLVNTPQGLLTFKDVALDFSLEEWERLSFAQRTLYIDVMLENYNNLLFVENHCIRGK
YRKVLDQDSQYIVHEHMNIQEKSSKWDKLSKVLLDSPQYTPYKTYHSSLQYWNQKRLKPR
NTKEVCKYNDSVNSVSLFSTISLNQGIHMQKKKHKRNAEFEKVFVSKHKDMVKQKNTGVN
PYKCSEFHKYLTQREKLQTQQRIYHGKKPYKSSKSDKCFTHQIHLRSHQGIHTGEKPHKC
SECDKCFTHKFNLRAHQRIHTGEKLYKCSECDKCFTHKSRLNYHQRIHTGEKPHKCSECD
KCFTHKFNLRAHQIIHTGEKPHKCSECDKCFTHKFNLRAHQRIHTGEKPYKCSECDKCFT
RKFHLGIHHRIHTGEKPYKCSECDKCFTGKGSLRIHQRIHIGEKPYKCSECDKCFTGKGS
LRIHQRIHTGERPHKCSECDKCFTGKGSLRIHQRMHTGEKPYKCSECDKCFTQKSHLNIH
QGIHTGEKPYKCSECDKCFTHKSHLINHQKIHTGEKPYK
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgagtgagtctctggtaaatacaccacagggtctgttaactttcaaggacgtggccttg
gacttctcactggaggaatgggaacgtctcagttttgctcagaggacactgtacattgat
gtgatgttggagaattacaacaatctgttgtttgtggaaaatcattgcatacgtggaaag
tataggaaggtcttggatcaagacagccagtacattgtccatgaacacatgaatattcaa
gagaagtcttctaaatgggacaagcttagcaaggtgcttcttgattccccccaatataca
ccttacaaaacttatcacagctctcttcaatactggaaccaaaaaagacttaagcccagg
aacactaaagaagtttgcaaatacaatgactctgtaaacagtgtaagtttgttttctacc
attagtctcaatcaaggaatccacatgcagaagaaaaaacacaagcgaaatgcagaattt
gagaaggtttttgtttctaaacataaagacatggtgaaacaaaaaaatactggagtgaac
ccttacaaatgcagtgaatttcacaaatatcttacccagagagaaaaacttcaaactcag
cagagaatttatcatggaaagaaaccttacaaaagtagtaaaagtgacaaatgctttacc
catcagatccatcttagaagtcatcagggaattcatacaggagagaaacctcacaaatgt
agtgaatgtgacaaatgctttacccacaaatttaatttgagagctcatcagagaattcat
acgggagagaaactttacaaatgtagtgaatgtgacaaatgctttactcacaaatcccgt
cttaattatcatcagagaattcatacaggagagaaacctcacaaatgtagtgaatgtgac
aaatgctttacccacaaatttaatttgagagctcatcagataattcatacaggagagaaa
cctcacaaatgtagtgaatgtgacaaatgctttacccacaaatttaatttgagagctcat
cagagaattcacaccggagagaaaccttacaaatgcagtgaatgtgacaaatgctttacc
cgaaaattccatcttggtattcatcatagaattcatacaggagagaaaccttacaaatgc
agtgaatgtgacaaatgctttactggaaaaggcagtctgagaattcatcagagaattcat
ataggagagaaaccttacaaatgtagtgaatgtgacaaatgctttactggaaaaggcagt
ctgagaattcatcagagaattcatacaggagagagacctcacaaatgtagtgaatgtgac
aaatgctttactggaaaaggcagtctgagaattcatcagagaatgcatacaggagagaaa
ccttacaagtgtagtgaatgtgacaaatgctttacccaaaaatcccatcttaatattcat
cagggaattcatacaggagagaaaccttacaaatgcagtgaatgtgacaaatgctttacc
cacaaatcccatcttattaatcatcagaaaattcatacaggagagaaaccttacaaatag

DBGET integrated database retrieval system