KEGG   Mus musculus (mouse): 50760
Entry
50760             CDS       T01002                                 

Gene name
Fbxo17, Fbg4, Fbx17, Fbxo26
Definition
(RefSeq) F-box protein 17
  KO
K10101  F-box protein 17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    50760 (Fbxo17)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    50760 (Fbxo17)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     50760 (Fbxo17)
Lectins [BR:mmu04091]
 F-box lectins
  50760 (Fbxo17)
SSDB
Motif
Pfam: FBA F-box-like F-box
Other DBs
NCBI-GeneID: 50760
NCBI-ProteinID: NP_056611
MGI: 1354707
Ensembl: ENSMUSG00000030598
Vega: OTTMUSG00000022895
UniProt: Q9QZM8 Q3V064
Position
7; 7 B1
AA seq 286 aa
MGARPSRRQMTEARRLALTKLPPELLVQVLSHVPPRALVTRCRPVCRAWRDLVDGPSIWL
LQLARDRSAEGRALYALAQRCPADADADADADGNRHDEFPFCALARFCLRAPFGRNLIHN
SCGEQGFRGWEVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFEWCSKRQLVDLVKEGVWQE
LLDSGQIEICIADWWGARENCGCIYRLRVRLLDEYENEVVKFSASPNPVLQWTERSCRQV
SHVFTNFGKGIRYVSFEQYGRDTRSWVGHYGALVTHSSVRVRIRLS
NT seq 861 nt   +upstreamnt  +downstreamnt
atgggagcgcggccctcgcgacggcagatgactgaagctcggcgcctggctctaaccaag
ctgccccctgagctgctggtgcaggtgctgagccacgtgccgcctcgcgcgttagtgacc
cgctgccggccagtgtgccgggcctggcgcgacctggtagatggcccaagtatatggctg
ctgcaactggctcgcgaccgcagcgcggagggcagagccctctacgccttggcccagcgc
tgtcccgccgacgccgacgccgacgccgacgccgacggcaaccgccacgacgagttccca
ttctgcgctctggcccgattctgcctgagagcgccgtttggccgcaacctcatccacaac
tcctgcggagaacagggcttcagaggttgggaagtggagcacggcggaaatggttgggcc
gtggaaaagaatttgacgctggtaccaggggctccttcccagacctgctttgtgacttct
tttgagtggtgctccaagaggcagcttgtagacctggtgaaggaaggagtatggcaggag
ctgttggacagtggccagattgagatctgcatagctgactggtggggcgcccgtgagaac
tgcggctgcatctaccggcttcgagttcgcctactggatgaatatgaaaacgaagtggtc
aagttctctgcctcacccaacccagtccttcagtggactgagaggagctgccgacaagtc
tctcacgtcttcactaactttggcaagggcatccggtatgtgtcttttgagcagtatggg
agagacacgcgttcctgggtgggacactacggtgcccttgtaactcactccagtgtgcgg
gtcaggatccgtctgtcctag

DBGET integrated database retrieval system