KEGG   Mus musculus (mouse): 75710
Entry
75710             CDS       T01002                                 

Symbol
Rbm12, 5730420G12Rik, 9430070C08Rik, AI852903, SWAN, mKIAA0765
Name
(RefSeq) RNA binding motif protein 12
  KO
K24526  RNA-binding protein 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    75710 (Rbm12)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    75710 (Rbm12)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 75710
NCBI-ProteinID: NP_083673
MGI: 1922960
Ensembl: ENSMUSG00000089824
Vega: OTTMUSG00000016088
UniProt: Q8R4X3
Structure
PDB: 
2CQP

Position
2; 2 H1
AA seq 992 aa
MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRT
GGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLP
AIVPNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPSMGTSFGSPTFSSTIPSTAS
PMNTVPPPPIPPIPAMPSLPPLPSIPPIPVPPPVPTLPPVPPVPPIPPVPSVPPMTTLPP
MSGMPPLNPPPVAPLPAGMNGSGAPIGLNNNMNPVFLGPLNPVNSIQMNSQSSVKSLPIN
PDDLYVSVHGMPFSAMENDVREFFHGLRVDAVHLLKDHVGRNNGNGLVKFLSPQDTFEAL
KRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSMGPSGQAHPPPQTLPRSKSPSGQKRS
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRN
DADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQRELVLNPEGEVS
SAKVCAHITNIPFSITKMDVLQFLEGIPVDESAVHVLVDNNGQGLGQALVQFKTEDDAHK
SEHLHRKKLNGREAFVHIVTLEDMREIEKNPPAQGKKGLKISVPGNPAVPVIPSAGMPAA
GIPTAGIPGAGLPSAGMPGAGMPSSGMPGPGMPGPGIPGAGIPGPAMPGPAMPGPAMPGP
AMPGPAMPGPAMPGPAMPGPAMPGPAIPGPAIPGPAIPGAGIPSAGGEEHVFLTVGSKEA
NNGPPFNFPGNFGGPNAFGPPLPPPGLGGAFGDVRPVMPSVGNSGLPGLGLEVPGFGGAP
NNISGPSGFGGIPQNFGNGPGSLNAPPGFGSGPPGLGSVPGHLSGPPAFGPGPGPGPIHI
GGPPGFGASSGKPGPTIIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEA
MVAFESRDEATAAVIDLNDRPIGSRKVKLVLG
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggctgtggtcatccgtttgcaaggtctcccaattgtggcggggaccatggacattcgc
cacttcttctctggattaaccatccccgatgggggcgtgcatattgtagggggtgaactg
ggtgaggctttcatcgtttttgccactgatgaagatgcaaggcttggtatgatgcgcaca
ggtggtactattaaagggtcaaaagtaacactattattgagtagtaaaacagaaatgcaa
aatatgattgaactgagtcgtaggcgttttgaaactgccaacttagatattccgccagca
aatgctagtagatcaggaccaccacctagctcagggatgagcagcagggtgaacttgcca
gcaatagtacccaactttaataatccttcgccaagtgtagtaactgctaccacttctgtt
catgagagcaacaaaaacatacagacattttccacagccagcgtaggaaccgctcctcca
agcatggggacttcttttgggagcccaacgttcagttcaaccattccaagtacagcttct
ccaatgaacacggtcccaccgccaccgattcctccaatcccagcgatgccatctttgcca
ccgctgccatccattcccccaataccagttcctcctccggtaccaacattgcctcctgtg
ccacctgttcctcccattcccccagtcccttcggtgccacctatgaccacactgcctcct
atgtcaggcatgccacccttgaatccaccacctgtggcacctttacctgctggaatgaat
ggctctggagcacctatcggtctgaacaataatatgaatcctgtgtttctgggtccatta
aatcctgttaactctatacagatgaattctcaaagcagcgtgaagtctcttcccatcaac
cctgatgatctgtatgtgagtgtgcatggaatgcccttttctgcaatggaaaatgatgtc
agagagtttttccatgggctccgagtcgatgcagtgcatttgttaaaagatcatgtaggt
cgaaataatgggaatggattggttaagtttctctcccctcaagatacatttgaagctttg
aaacggaacagaatgctgatgattcaacgctatgtggaagtcagtcctgccacagagaga
cagtgggtagctgctggaggtcatatcacttttaagcaaagtatggggccttctggacaa
gcccaccctcctccacagacacttccaaggtcaaaatcgcccagtgggcagaaaaggtca
agatcaagatcaccacatgaggctggcttttgtgtttacttaaaagggctaccatttgaa
gcagaaaacaaacatgtcattgatttttttaagaagttggatattgtggaagatagtatt
tatatagcttatggacccaatgggaaagcaactggtgaaggctttgtagaatttaggaat
gatgctgactataaggctgctctctgtcgtcataaacaatacatgggcaatcgctttatt
caagttcatccaataactaagaaaggtatgcttgaaaagatagatatgattcgaaaacga
cttcagaacttcagctatgaccagagggaactggtgttaaatccagagggggaagtcagt
tctgccaaagtctgtgcccatataacaaacattccattcagcatcaccaagatggatgtt
cttcagttcctagaaggaatcccagtggatgagagtgctgtgcatgttcttgttgataac
aatgggcaaggtctagggcaagcattggttcagtttaaaactgaagatgacgcacataaa
tctgaacacttacaccgtaaaaagctgaatgggagagaagcttttgttcatatagttacc
ctagaagatatgagagagattgagaaaaatcccccagcccaaggaaaaaagggtctaaag
atatctgttccaggtaatcctgcagtaccagtgatacctagtgcagggatgcctgctgct
ggaattcccactgccgggataccaggggctggattgcctagtgctggaatgcctggtgct
gggatgcccagctctggaatgcctggtcctggaatgcccggtcccggaatacccggtgcg
ggaatacctggtcccgcaatgcctggtcctgcaatgcctggtcccgcaatgcctggtccc
gcaatgcccggtcccgcaatgcccggtcccgcaatgcccggtcccgcaatgcccggtccc
gcaatgcccggtcccgcaatacctggtcccgcaatacctggtcccgcaatacctggtgct
ggcatccccagtgcaggaggagaagagcatgtcttcttgactgtaggatcaaaggaggcc
aataatgggccaccatttaacttccctggtaattttggtgggcccaatgcctttgggcca
ccactcccccctccaggattagggggtgcctttggtgatgttaggcctgttatgccttcg
gttggaaatagtggtttgcctggcctaggactggaagttccaggttttggaggtgcacca
aataatataagtgggccatcaggatttggggggatccctcagaactttggaaatggccca
ggtagtttaaatgctcctcctggttttggaagtggaccccctggtcttggaagtgttcct
gggcatttgagtgggcctccagcctttgggcctgggcctgggcctggcccaatccatatt
gggggtccccctggctttggagctagctctggaaaaccaggacctacaataattaaggtg
cagaacatgccttttactgtatctattgatgaaattttagatttcttttatggttatcaa
gtaattccaggttcagtatgtttaaaatacaatgaaaaaggtatgcctacaggtgaagcc
atggtggcctttgaatctcgggatgaagccacagctgctgtcattgacttaaatgatagg
cctataggttcaagaaaggtaaaacttgttttagggtag

DBGET integrated database retrieval system