KEGG   Mus musculus (mouse): 76626
Entry
76626             CDS       T01002                                 

Gene name
Msi2, 1700105C15Rik, AI451722, AI563628, AW489193, Msi2h
Definition
(RefSeq) musashi RNA-binding protein 2
  KO
K14411  RNA-binding protein Musashi
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    76626 (Msi2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    76626 (Msi2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     76626 (Msi2)
SSDB
Motif
Pfam: RRM_1 RRM_7 PHM7_cyt
Other DBs
NCBI-GeneID: 76626
NCBI-ProteinID: NP_473384
MGI: 1923876
Ensembl: ENSMUSG00000069769
Vega: OTTMUSG00000008130
UniProt: Q920Q6 Q3TE41
Position
11; 11 C
AA seq 346 aa
MEANGSPGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKR
SRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSAN
TVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMV
ECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQ
FPGFPAAAYGPVAAAAVAAARGSVLNSYSAQPNFGAPASPAGSNPARPGGFPGANSPGPV
ADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggaggcaaatgggagcccaggcacctcgggcagcgccaacgactcccagcacgacccc
ggtaaaatgtttatcggtggactgagctggcagacctcaccagatagccttagagactat
tttagcaaatttggagaaattagagaatgtatggtcatgagagatcccacaacgaaacgc
tccagaggcttcggtttcgtcaccttcgcagacccagcaagtgtagataaagtattaggt
cagccccaccatgagttagattccaagacgattgacccaaaagttgcatttcctcgtcga
gcgcaacctaagatggtcacaagaacaaagaaaatcttcgtaggaggattgtctgcaaac
acagtagtggaagatgtaaagcagtatttcgagcagtttggcaaggtagaggatgcgatg
ctgatgttcgacaaaaccaccaacaggcacagagggtttggctttgtcacctttgagaat
gaagacgttgtggagaaagtctgtgagattcatttccatgaaatcaataataaaatggta
gaatgtaagaaagctcagccgaaagaagtcatgttcccacctgggacaagaggccgggcc
cgggggctgccatacaccatggatgcgttcatgcttggcatggggatgctgggctacccc
aactttgtggcaacctatggcagaggctaccccggatttgctcctagctatggctaccag
ttcccaggcttcccggcggcagcttatggaccagtggcagcggcagctgtggcagcggct
cgaggatcagtcctgaatagctacagtgctcaaccgaattttggcgcgcccgcttccccg
gcaggctccaacccggcgcggcccggaggcttcccgggggccaacagcccaggacctgtc
gccgatctctacggccctgccagccaggactccggagtggggaattacataagcgcggcc
agcccacagccgggctccggcttcggccacggcatagctggacctttgattgcaacggcc
tttacaaatggataccactga

DBGET integrated database retrieval system