KEGG   Mus musculus (mouse): 76803
Entry
76803             CDS       T01002                                 

Symbol
Zfp998, 2410141K09Rik, 4930482J15Rik, Ayu21-35, Gt(pU21)35Imeg, Snerv1
Name
(RefSeq) zinc finger protein 998
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB ZZ Zn-ribbon_8 zf-C2H2_11 zinc_ribbon_15 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 76803
NCBI-ProteinID: NP_001277125
MGI: 1924053
Ensembl: ENSMUSG00000074832
Vega: OTTMUSG00000037185
UniProt: Q8C1L2 K7N769
Position
13; 13 B3
AA seq 464 aa
MDAMTFDDVHVNFTKEEWNLLEPSQMNLYKDVMLETYWNLTSIGYKWEDHHIEEPCQSSR
RHTRHVRSHSWKKLYECNQCGKAFTSHSSLRYHKRTHTGEKPYECNHCGKAFARPAHLQR
HKRTHTGEKPYECNQCSKAFSCHSGLRYHKRTHTGEKPYECNQCGKAFARPADLQCHKRT
HTGEKPYECNQCGKAFARPANLQCHKRTHTGEKPYECNQCGKAFSCQGGLRYHKRTHTGE
KPYECNQCGKAFARPSHLQCHKRTHTGEKPYECNQCGKAFSSHISLRYHKRTHTGEKPYE
CNQCGKAFSGHSGLRYHKRTHTGEKPYECNQCGKAFATPSHLQCHKRTHTGEKPYECNQC
SKAFARPAHLQHHKRTHTGEKPYECNQCGKAFARLSHLQCHKRTHTGEKPYECNQCGKAF
SCHNSLRYHKGTHTGEKPYECNQCGKALATSTHLQCHKRTHTGE
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggatgcaatgacttttgacgatgtgcatgtgaacttcactaaagaagagtggaatttg
ctggaaccttcccagatgaatctctacaaagacgtgatgttggagacctactggaacctt
acttctataggctacaaatgggaagaccatcatattgaagaaccatgtcaaagttctcga
agacatacaaggcatgtcaggagtcatagttggaagaaactctatgaatgtaatcaatgt
ggtaaagcctttacctctcacagtagtctcagatatcataaaagaacccatactggagag
aaaccttatgaatgtaatcattgtggtaaagcctttgcaagacctgctcatctccaaaga
cataaaagaacccatactggagagaaaccttatgagtgtaatcaatgtagtaaagccttt
tcctgtcacagtggtctcagatatcataaaagaacccatactggagagaaaccttatgaa
tgtaatcaatgtgggaaagcctttgcaagacccgctgatctccaatgtcataaaaggacc
catactggagagaaaccttatgaatgtaatcaatgtgggaaagcctttgcaagacccgct
aatctccaatgtcataaaagaacccatactggagagaaaccttatgaatgtaatcaatgt
ggtaaagccttttcttgtcagggtggtctcagatatcataaaagaacccatactggagag
aaaccttatgaatgtaatcaatgtgggaaagcctttgcaagacccagtcatctccaatgt
cataaaagaacccatactggagagaaaccttatgaatgtaatcaatgtggtaaagccttt
tcctctcacattagtctcagatatcataaaagaacccatactggagaaaagccttatgaa
tgtaatcaatgtggtaaagccttttccggtcacagtggtctcagatatcataaaagaacc
catactggagaaaaaccttatgaatgtaatcagtgtggtaaagcctttgcaacacccagt
catctccaatgtcataaaagaacccatactggagagaaaccatatgaatgtaatcaatgt
agtaaagcctttgcaagacccgctcatctccaacatcataaaagaacccatactggagag
aaaccttatgaatgtaatcaatgtgggaaagcctttgcaaggctcagtcatctccaatgt
cataaaagaacccacaccggagagaaaccttatgaatgtaatcaatgtgggaaagccttt
tcctgtcacaatagtctcagatatcataaaggaacccatactggagaaaaaccttatgaa
tgtaatcagtgtggtaaagcccttgctacatccactcatctccaatgtcataaaagaacc
catactggagagtaa

DBGET integrated database retrieval system