KEGG   Mus musculus (mouse): 100017
Entry
100017            CDS       T01002                                 

Symbol
Ldlrap1, A, AA691260, ARH2, Ar, Arh, Arh1, FHCB1, FHCB2
Name
(RefSeq) low density lipoprotein receptor adaptor protein 1
  KO
K12474  low density lipoprotein receptor adapter protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100017 (Ldlrap1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    100017 (Ldlrap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100017 (Ldlrap1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    100017 (Ldlrap1)
SSDB
Motif
Pfam: PID_2 PID PTB TMEM164
Other DBs
NCBI-GeneID: 100017
NCBI-ProteinID: NP_663529
MGI: 2140175
Ensembl: ENSMUSG00000037295
Vega: OTTMUSG00000011121
UniProt: Q8C142
Position
4; 4 D3
AA seq 308 aa
MDALKSAGRALIRSPSLAKQSWAGGRHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERP
KGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTA
DKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSKEEKEK
REKANQEGGDVPGTRRDSTPSLKTLVATGNLLDLEEVAKAPLSTVSANTNNVDETPRPQV
LGNNSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLSAQDIHYAQCLSPTDWDKPDSSGID
QDDDVFTF
NT seq 927 nt   +upstreamnt  +downstreamnt
atggacgcgctcaagtcggcggggcgcgcgctaatccggagccccagtctggccaagcag
agctgggcgggcggccggcaccgcaagttgccagagaactggacggacacgcgggagaca
ctgctggagggcatggttttcagcctcaagtaccttggtatgacgctggtggagcggccc
aagggcgaggagctgtctgcagctgctgtcaagaggatcgtagctacagccaaggccagc
gggaagaagctgcagaaggtgacactcaaggtgtcaccccgggggatcatcctgaccgac
agcctcactagccagctcatcgagaacgtgtccatttacaggatctcctactgcactgca
gacaagatgcacgacaaggtgttcgcctacatcgcccagagccagcagaacgagagcctc
gagtgccacgccttcctctgcaccaagcggaaagtggcccaagccgtcaccctgactgta
gcccaagccttcaaagttgcctttgagttttggcaggtgtccaaggaagagaaagagaaa
agggagaaagccaaccaggaaggaggagacgtcccagggacccgacgggacagcaccccc
tcactgaaaaccttggtcgctaccgggaacctgctggatttggaagaggtggctaaggcc
ccgttatctacagtcagcgctaataccaacaacgtggacgagacaccacggcctcaggtc
ttgggcaacaacagcgtcgtctgggagctggatgacggcctggacgaagcattttcaagg
ctggcgcagtcccggacaaaccctcaagtcctggacactggactgtcagcacaggacatc
cattatgcacagtgcttatcgcccaccgactgggacaagcctgacagcagtggcattgat
caagatgatgacgtcttcaccttctga

DBGET integrated database retrieval system