KEGG   Mus musculus (mouse): 100033459
Entry
100033459         CDS       T01002                                 

Gene name
Ifi208, 9830148g24rik, E430029J22Rik, NG2creBAC, Pydc3, Pyr-rv1, Tg(Cspg4-cre)1Akik
Definition
(RefSeq) interferon activated gene 208
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PYRIN HERV-K_REC zf-RING_11
Other DBs
NCBI-GeneID: 100033459
NCBI-ProteinID: NP_001156410
MGI: 2442822
Ensembl: ENSMUSG00000066677
Vega: OTTMUSG00000033992
UniProt: Q3V3Q4
Position
1; 1 H3
AA seq 588 aa
MTGEMVNYYKQIVLLSGLEYMNDYNFRALKSLLNHDLKLTKNMQDDYDRIKIADLMEEKF
PEDAGLSKLIEVCEDIPELAARVDILRKEMEKVKNKTKIKSESSPLPLTSSLMEAWEVEP
AMVTASSEESKDTIPESPDTMTTQFLEEKPKFPLLSATSTSQAEGEPLTPQRFPTTASSS
LQTPLEPTEILSTILATSQGSSAPYSTCDKSSRVPPVTVSSSLQTIQTCQATSTLPCSHH
TSLESPKTEPSSVQATQMTQAIKASGHNCPQVPASAVSSSFIKPQVTPAMLLSGVQTPLM
PQATVPSRAQTFQLTPAKMTSGCNSPQMSAATVYSSYSNPQVTPVHSSVQILQMNLAAMT
IGCNSPHVSAATVSSPYNNPWVTPATFPRNAQTLQLYPAAMAHACNSPQVSAATISSSYN
NTPQVSSVTVPRSFPAMSLSPAKPLKAKIGSHLGATDQLVKDHQFEDNEMQNPQSGLGTG
LSDQPRLSRTQSRTEKRRRKQEEQPLATKMKRLSLSPPQTTARRVNPMPTWGQLKKLTRE
AEGLVQRTGNKLSSETMFLAMLALIAMQSSSEICNYDKGGHSGTSSEK
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgactggagagatggtgaattactacaagcaaattgttcttctgtctggattagaatat
atgaatgactataactttagagcacttaagtccttactgaaccatgacctaaaactgact
aagaacatgcaagatgattatgacagaattaagattgctgacttaatggaagaaaagttc
ccagaggatgctggattgagcaaactgatagaagtatgtgaagacattccagaacttgca
gctcgtgttgatatacttagaaaagagatggagaaagttaaaaataaaaccaaaataaaa
tcggaatccagtcctctcccacttacctccagcctgatggaagcttgggaagtagaacca
gctatggtgacagcttcatcagaggaaagcaaagatactatccctgaatcacctgatacc
atgacaacacagtttttggaggaaaagcctaagtttccattactttcagcaaccagcaca
agccaggctgagggtgaaccactgactccccagaggtttccaacaacagcctccagcagt
ctccagacacccctggagcctacagaaatattgtccaccatattggcaacatctcagggt
tcttcagcaccatattccacctgtgacaaatcttctcgggtgcctccagtgacagtctcc
agcagcctccagaccatccagacctgtcaggcaacctcaacacttccttgtagtcaccac
acttctctggagtctccaaaaacagagcccagcagtgtccaggccactcagatgactcaa
gcaataaaggcaagtggtcataattgtcctcaggtgcctgcatcagcagtatccagcagt
ttcattaaacctcaggtgaccccagcaatgttactcagcggtgtccaaactcctttgatg
cctcaagcaacagtgcccagccgtgcccagacctttcaactaaccccagcaaaaatgacc
agtggttgtaatagtcctcagatgtctgcagcaacagtatacagcagttacagtaaccct
caggtgactccagtgcacagcagtgtccagatcttgcaaatgaacctagcagcaatgacc
attggttgtaatagtcctcatgtatctgcagcaacagtatccagcccttacaataaccct
tgggtgactccagcaacatttccccgaaatgcccagaccttgcaactctacccagcagcc
atggcccatgcctgtaatagtcctcaggtgtctgcagcaacaatatccagcagttacaat
aatacccctcaggtgtcttctgtaacagtgcccaggagttttcctgccatgtctctgtct
ccagcaaagccactcaaggcaaagataggatctcatctgggtgctacagaccagctggta
aaggatcaccagtttgaggacaatgaaatgcagaatccccagtctggattagggacaggc
ttatcagatcagccccgcctgtcccgaacacaaagccgcacagagaagagaaggagaaag
caggaagaacagccgcttgcaaccaaaatgaagagactctccctatctccaccacagaca
acagcaaggagagtcaacccgatgccaacctggggacaactaaagaagctgactcgtgag
gcggagggactagtacagagaacgggcaacaagctttcatcagagacaatgtttttggcc
atgcttgctttaatagctatgcagagttcttctgagatttgtaactacgacaagggagga
cattctggaacttcatctgaaaaataa

DBGET integrated database retrieval system