KEGG   Mus musculus (mouse): 100037258
Entry
100037258         CDS       T01002                                 

Gene name
Dnajc3, AA408985, AU067833, Dnaj, Dnajc, Dnajc3a, Dnajc3b, P, Prkri, mp5, mp58, p58, p58IPK
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C3
  KO
K09523  DnaJ homolog subfamily C member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100037258 (Dnajc3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100037258 (Dnajc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    100037258 (Dnajc3)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   100037258 (Dnajc3)
SSDB
Motif
Pfam: TPR_1 TPR_19 TPR_2 DnaJ TPR_16 TPR_8 TPR_14 TPR_11 TPR_9 TPR_17 TPR_12 ANAPC3 TPR_20 TPR_21 TPR_6 PRAI NARP1 TPR_10 Ndufs5
Other DBs
NCBI-GeneID: 100037258
NCBI-ProteinID: NP_032955
MGI: 107373
Ensembl: ENSMUSG00000022136
UniProt: Q91YW3 Q3UFV9
Structure
PDB: 
3IEG

Position
14; 14 E4
AA seq 504 aa
MVAPGSVGSRLGAVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
VAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtggcccccggctcggtgggcagccggctgggcgcggtgttcccgttcctgctggtc
ctggtggacctgcagtacgaaggcgctgagtgtggagtaaatgcggatgtggagaagcat
cttgaattggggaagaaattactcgcagccggacagctagccgacgccttatcacagttt
cacgctgcagttgatggtgaccccgataactatatcgcatactataggagagctaccgtc
ttcttagccatgggaaaatccaaagcagcgctgcccgacctcaccaaagtgattgcgctg
aagatggactttactgccgcaagactacagagaggtcacctactgctcaaacaagggaag
cttgacgaagcagaagacgatttcaagaaagtgctcaaatctaaccccagtgagcaggag
gagaaggaagccgagtctcagcttgtaaaagctgacgagatgcagcggctgcgctcccaa
gcgctcgacgcctttgacggtgccgattacactgctgctataaccttccttgataagatt
ttagaggtttgtgtttgggatgcagaactgcgtgaactgcgagcagaatgcttcataaag
gaaggagagcccaggaaagccatcagcgacttaaaggctgcttcaaagctgaagagtgac
aacacagaggccttttacaaaatcagcacactctactaccagctaggagaccatgagctg
tctctcagtgaagttcgtgaatgtctgaaacttgaccaggatcacaagcggtgttttgca
cactataagcaagtgaagaaacttaacaagctgattgagtcagctgaagagctgatccga
gatggcagatacacagatgcaaccagcaaatatgaatcagtcatgaaaacagagcccagt
gttgctgagtacacagtgcgctcgaaggagaggatctgccactgcttctctaaggatgag
aagcccgtggaagccattaggatatgttctgaagttttacagatggagcccgacaatgtg
aatgctctgaaagaccgagccgaggcctacttaatagaggaaatgtacgatgaagccatt
caggattatgaagctgctcaggagcacaatgaaaatgaccagcagattcgggaaggctta
gagaaagcccagcggttactgaagcagtcacagaaacgagattattataaaatcttggga
gtaaaaagaaatgccaaaaaacaagaaatcattaaagcataccgaaagttagcactgcag
tggcatccagataatttccagaatgaagaagaaaagaaaaaagcagagaaaaagttcatt
gacatagcagctgctaaagaagtcctctcagacccagaaatgagaaagaagtttgatgat
ggagaagatcctcttgatgcagagagtcaacaaggaggtggtggcaaccccttccacaga
agttggaactcatggcaagggtttaaccccttcagctcaggcggaccgttcagatttaag
ttccacttcaattaa

KEGG   Mus musculus (mouse): 13418
Entry
13418             CDS       T01002                                 

Gene name
Dnajc1, 4733401K02Rik, AA960110, D230036H06Rik, Dna, Dnajl1, ERdj, ERdj1, ERj1p, MTJ1
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C1
  KO
K09521  DnaJ homolog subfamily C member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    13418 (Dnajc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    13418 (Dnajc1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   13418 (Dnajc1)
SSDB
Motif
Pfam: DnaJ Myb_DNA-binding Myb_DNA-bind_6 DUF4234
Other DBs
NCBI-GeneID: 13418
NCBI-ProteinID: NP_001177746
MGI: 103268
Ensembl: ENSMUSG00000026740
Vega: OTTMUSG00000011538
UniProt: Q61712
Position
2; 2 A3
AA seq 552 aa
MWVPGFGSARLPQRRRSGLESSSVRPLWLLLLFLLAAVRPVRAWESGDLELFDLVEEVQL
NFYEFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQR
YDDVLINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLDELLG
RKKRERKKKTGSKSVDAAKLGASEKNERLLIKPQWHDLLPCKLGIWFCLTLKALPHLIQD
AGQFYAKYKETKLKEKEDALARIEIETLQKQKKVKVKKPKPEFPVYMPLENTYIQSYDHG
TSIEEIEEQMDDWLENRKRTQKRQAPEWTEEDLSQLTRSMVKFPGGTPGRWDKIAHELGR
SVTDVTTKAKELKDSVTSSPGMTRLSELKSNGQNSRPIKIATALPDDIITQREDSAGAME
DEEHEAAEGEQESATTEARPRRRKSARAAEAVTRVEPEEKLRGKRQKDFDISEQNDSSDE
EKQRKERTRAAEEAWTQSQQKLLELALQQYPKGASDRWDKIAKCVPSKSKEDCIARYKLL
VELVQKKKQAKS
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtgggttcccggcttcggatccgcgcgacttccccagcgccggcgctccgggttggag
tcatcctcggtgcggccgctgtggctgctgctgctgttcctgctggcagccgtgcggcca
gtgcgcgcctgggagagcggagacctggagttgttcgacttggtggaagaggtgcagttg
aacttctacgagttcctcggggtgcagcaggatgcttcatctgcagacatcagaaaagca
tatcgtaagctttcactaaccttacatccagacaagaataaagatgaaaatgcagaaact
caatttagacaattggtggccatttatgaagttttaaaggatgatgaaagaaggcagagg
tatgatgatgttctgatcaatggacttccagattggcgacagcctgtattctactacagg
cgagtgagaaaaatgagcaatgctgagctggctttgctcttgttcattattctcacagtg
ggtcactatgctgtggtttggtccatctacctggaaaagcaactggatgaactgcttggt
agaaaaaagagagaaaggaagaagaagacaggaagcaagagtgtggacgcagcaaaactt
ggtgcttctgaaaagaacgaaagattgcttataaaaccacaatggcatgatttgcttcca
tgcaaactggggatttggttttgccttacactaaaagcattgcctcatctaatccaggat
gctgggcagttttatgcaaaatataaggagacaaaattgaaggaaaaagaagacgcactg
gctagaattgaaattgaaacccttcaaaaacagaagaaagttaaagttaaaaaaccaaaa
ccagaatttcctgtgtatatgcctttagaaaatacgtatattcagtcttatgatcatgga
acttctattgaagaaattgaggagcaaatggatgactggctggaaaacaggaaaagaaca
cagaaaagacaggcacctgaatggacagaagaggacctcagtcaactgacaagaagtatg
gttaagttcccaggagggactccaggtcgatgggacaagattgcccatgaattgggtcga
tctgtgacagatgtgacaaccaaagccaaggaactgaaggactcagtcaccagctccccc
ggaatgaccaggctctctgaacttaagtcaaatggtcagaattccaggccaatcaagata
gccacagccttgccagatgacatcatcacgcagcgggaggactcagcaggggccatggag
gatgaggagcacgaggctgctgagggtgagcaggagtcagcgaccacagaagcccgacct
cggaggcggaagtcagccagggcggctgaggctgtaaccagagtggagccagaggagaag
ctgagaggaaagaggcaaaaagactttgatatatcagaacaaaacgattccagtgacgaa
gagaaacaacgaaaagaaagaactcgtgctgcagaggaggcgtggactcagagtcagcag
aaacttctggaattggcattacagcaataccctaaaggagcttctgaccgctgggacaaa
atagccaaatgtgtcccgtctaagagtaaggaagactgcattgctagatacaagctgctg
gttgaactggtccaaaagaaaaagcaggctaaaagctga

KEGG   Mus musculus (mouse): 66861
Entry
66861             CDS       T01002                                 

Gene name
Dnajc10, 1200006L06Rik, D2Ertd706, D2Ertd706e, ERdj, ERdj5, JP, JPDI
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C10
  KO
K09530  DnaJ homolog subfamily C member 10 [EC:1.8.4.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    66861 (Dnajc10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    66861 (Dnajc10)
   04131 Membrane trafficking [BR:mmu04131]
    66861 (Dnajc10)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     66861 (Dnajc10)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   66861 (Dnajc10)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    66861 (Dnajc10)
SSDB
Motif
Pfam: Thioredoxin DnaJ Thioredoxin_2 Thioredoxin_8 OST3_OST6 Thioredoxin_6 Redoxin TraF RMMBL
Other DBs
NCBI-GeneID: 66861
NCBI-ProteinID: NP_077143
MGI: 1914111
Ensembl: ENSMUSG00000027006
Vega: OTTMUSG00000013339
UniProt: Q9DC23 Q9CUG0
Structure
PDB: 
3APQ 3APS 5AYK 5AYL 3APO

Position
2; 2 C3
AA seq 793 aa
MGVWLNKDDFIRDLKRISLCLLILYVVVVVGTDQNFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWSYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWREFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVTEL
STGNFVNAIETAFAAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDAQDSL
CKSLDTTASTTAYFPPGATLNDREKSSVLFLNSLDAKEIYMEIIHNLPDFELLSANQLED
RLAHHRWLVFFHFGKNENANDPELKKLKTLLKNEHIQVGRFDCSSAPGICSDLYVFQPCL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPASDKEPWLVDFFAPWC
PPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQSSIHEYEGH
HSAEQILEFIEDLRNPSVVSLTPSTFNELVKQRKHDEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSVDCQQYHSFCTQENVQRYPEIRFYPQKSSKAYQYHSYNGWNRDAYSL
RSWGLGFLPQASIDLTPQTFNEKVLQGKTHWVVDFYAPWCGPCQNFAPEFELLARMIKGK
VRAGKVDCQAYPQTCQKAGIKAYPSVKLYQYERAKKSIWEEQINSRDAKTIAALIYGKLE
TLQSQVKRNKDEL
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgggagtctggttaaacaaagatgactttatcagagacttgaagaggatcagtctctgt
cttctgatactgtacgtggtcgttgtggtgggcacagatcagaatttttacagtttactt
ggagtgtcgaaaactgcaagcagtagagaaataagacaagcctttaagaaattagcactg
aagttacatcctgataaaaacccgaataacccaaatgcacatggtgattttttaaaaata
aatagagcatatgaagtactcaaagatgaagatctacggaaaaagtatgacaaatatgga
gaaaagggacttgaagataatcaaggaggccagtatgagagctggagctactaccgttac
gatttcggtatttacgatgatgatcctgaaatcataacattagaaagaagagaatttgat
gctgctgtcaactctggagaactgtggtttgtaaacttttactccccaggatgttcgcat
tgccatgatttagcccccacttggagagaatttgctaaagaagtggatgggttgcttcga
atcggagctgtcaactgtggtgatgatcggatgctctgccgaatgaaaggagttaacagc
taccccagcctcttcatctttaggtctggaatggctgcagtgaagtacaatggagatcgg
tcaaaggagagcttagtggccttcgccatgcagcacgtcaggagcacagtgacagagctg
tcaacaggaaattttgttaatgccatagaaactgcttttgctgctggtgttggctggctg
atcacattctgctctaaaggagaagattgtttgacatcacagacccgactcaggcttagt
ggcatgttggacggccttgttaacgtgggatgggtggactgtgacgcccaggacagcctc
tgcaagagcctggataccacagccagcaccacggcttatttccctcctggagccactttg
aatgacagggaaaaatccagtgtgttgtttcttaattcattggatgctaaggaaatatac
atggaaatcatacataatcttccagactttgaactgctttcagcaaatcaactagaggat
cgtttggcacatcatcgctggcttgtattttttcattttggaaaaaatgaaaacgcaaat
gatcctgagttgaaaaaactgaaaactctacttaaaaatgagcatattcaagttggaagg
tttgattgctcttctgcaccgggcatctgctctgatctttatgtcttccagccctgccta
gcagtgtttaaaggacaaggaaccaaagaatatgaaattcatcatggaaagaagattcta
tacgatatacttgcttttgccaaagaaagtgttaattctcatgttaccacacttggacct
cagaacttccctgcaagtgacaaggaaccatggcttgttgacttctttgccccttggtgt
ccgccatgtcgtgcgcttttgccagagttacggaaagcatcaacactgctctacggtcaa
ctcaaagttggtaccttagactgtacaattcatgaaggactctgcaacatgtataacatc
caagcttatccaacgacagtggtattcaatcagtccagtattcatgagtatgaaggacat
cactctgcggaacagatcttggagttcatagaggatctcagaaacccttcagtggtctct
cttacacccagcactttcaatgagctggttaaacagagaaagcatgatgaagtctggatg
gtcgatttctattctccatggtgtcatccctgtcaggtcttgatgccagaatggaaacgc
atggcccggacgttaactggactgatcaatgtaggcagtgtggactgccaacagtatcat
tctttttgtactcaagaaaatgttcaaagataccccgagataagattttatccccaaaag
tcaagtaaagcctatcagtatcatagttacaatggctggaatagggatgcgtattccctg
agaagctggggtcttggatttttgccccaagcatccatagatttaacacctcagactttc
aatgaaaaagttctacaagggaaaactcactgggtggttgatttctatgctccttggtgt
ggaccttgccagaattttgctcctgagtttgaactcttggctaggatgatcaaaggaaaa
gtgagagccgggaaagtggactgtcaggcttacccccagacgtgccagaaagccggcatc
aaagcctaccccagtgtcaaactgtaccagtacgagagagcaaagaaaagtatttgggaa
gagcaaataaattccagagatgcaaaaactattgctgccttaatttatggaaaattggaa
acgctccaaagccaagtaaaaagaaataaggatgagctttga

KEGG   Mus musculus (mouse): 67838
Entry
67838             CDS       T01002                                 

Gene name
Dnajb11, 1810031F23Rik, ABBP, ABBP-2, AL024055, Dj9, ERdj, ERdj3, ERj3p
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B11
  KO
K09517  DnaJ homolog subfamily B member 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67838 (Dnajb11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    67838 (Dnajb11)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   67838 (Dnajb11)
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 67838
NCBI-ProteinID: NP_001177733
MGI: 1915088
Ensembl: ENSMUSG00000004460
Vega: OTTMUSG00000025893
UniProt: Q99KV1
Position
16; 16 B1
AA seq 358 aa
MAPQNLSTFCLLLLYLIGTVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDD
PQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGT
PRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQL
GPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLR
FRIKVVKHRIFERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRDKITRPGAKLW
KKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLLKQGPVQKVYNGLQGY
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggccccgcagaacctgagcaccttctgcctgttgctgctgtacctcatcgggactgtg
atcgccgggcgagatttctataagatcttgggggtgcctcgaagtgcctccataaaggac
attaaaaaggcctacaggaaactggccctgcagctccaccctgaccggaaccctgatgac
ccccaagcccaggagaaattccaggatctaggtgctgcttatgaggttctgtcagatagt
gaaaaacgaaaacagtacgatacttacggtgaagaaggcttgaaagatggccatcagagc
tctcatggggacattttttcacacttctttggagactttggcttcatgtttggaggaacc
cctcgtcagcaggacaggaatattccaagaggaagtgatatcatcgtagatctagaagtc
actctggaagaagtgtacgcaggaaattttgtggaagtagttagaaacaagcctgtggcc
aggcaggctcctggcaaacggaaatgcaactgtcggcaagagatgagaaccacacagctg
ggaccgggacgcttccaaatgacccaggaagtggtttgtgacgagtgccctaatgtcaaa
ttagtgaatgaagaacgaacactagaagtggaaatagagcctggggtgcgagatggcatg
gagtacccctttattggagaaggtgagccgcatgtggatggggaacccggagacttacgg
ttccgaatcaaagttgtcaagcaccggatatttgagaggagaggggatgacctgtacaca
aatgtgaccgtctcactggttgaggctctggttggctttgagatggacataactcacctg
gatggtcacaaggtccatatttcccgggacaagatcaccaggccaggagccaagctgtgg
aagaaaggggaagggctgcccaactttgataacaataacatcaagggctctttgataatc
acttttgatgtggactttccaaaagaacagctgacagaggaagcaaaagaaggtatcaag
cagcttctcaaacaaggccccgtgcagaaggtgtacaacgggctgcagggctattag

DBGET integrated database retrieval system