KEGG   Mus musculus (mouse): 100038489Help
Entry
100038489         CDS       T01002                                 

Gene name
Apela, Ela, Elabela, Ende, Gm10664
Definition
(RefSeq) apelin receptor early endogenous ligand
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 100038489
NCBI-ProteinID: NP_001284483
MGI: 3642370
Ensembl: ENSMUSG00000079042
Vega: OTTMUSG00000032906
UniProt: P0DMC4
Position
8 B3.1; 8
AA seq 54 aa AA seqDB search
MRFQPLFWVFFIFAMSLLFISEQKPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgcgattccagccccttttttgggtattttttatttttgccatgagtctcctttttatc
agtgaacagaaaccagttaactttcccaggagaagaaaactatacagacacaactgcttt
cgcaggagatgcattccacttcattctcgagtgcccttcccatga

DBGET integrated database retrieval system