KEGG   Mus musculus (mouse): 100038860
Entry
100038860         CDS       T01002                                 

Gene name
Olfr239, MOR267-, MOR267-10
Definition
(RefSeq) olfactory receptor 239
  KO
K04257  olfactory receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    100038860 (Olfr239)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    100038860 (Olfr239)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Olfactory
    100038860 (Olfr239)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100038860
NCBI-ProteinID: NP_997058
MGI: 3030073
Ensembl: ENSMUSG00000093884
Vega: OTTMUSG00000059243
UniProt: A0PK55
Position
17; 17 B1
AA seq 315 aa
MLGLNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMTTIWSEHSLHTPMY
LFLCALSISEIFYTFAIIPRMLADLLSTLHSIAFLACASQMFFSFTFGFTHSFLLTVMGY
DRYVAICHPLRYNVLMSPRGCACLVTWSWVGGSFMGTVVTTAIFNLTFCGPNEIHHFACH
VPPLLKLACGENVLEVAKGVGIVCITALLGCFLLILLSYAFIVVTILKIPSAEGRHKAFS
TCASHLTVVVVHYGFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKN
AMKKIFLSKLYPEKI
NT seq 948 nt   +upstreamnt  +downstreamnt
atgttggggctaaattacacctttgtgtcagagttcatcctcattggcttctctaccttc
cctcatcttcagctgatgttcttcctgctgttcctgctcatgtacctcttcacactgcta
ggcaacctgctcatcatgaccaccatctggagtgaacacagtctccacacacccatgtac
ctcttcctgtgtgccctctccatctctgagattttctacacctttgccatcatcccacgc
atgttggctgacctgctctccacacttcactccatcgcctttctggcctgtgccagccag
atgttcttctccttcacatttggcttcacccattcctttctactaaccgtcatgggttat
gaccgctacgtggccatctgtcacccactgagatacaatgtgctcatgagcccccgtggt
tgtgcctgcctggtaacctggtcctgggttggtggatcattcatggggacagtggtgacg
acagccattttcaacctcaccttctgtggacccaatgagatccaccattttgcttgtcat
gttccacctctattgaagttggcatgcggagagaatgtactggaggtggcaaagggtgta
ggaatagtgtgcatcacagccctcctgggctgctttctcctcatcctcctctcatatgcc
ttcattgtggttaccatcttgaagataccatcagctgagggtcggcacaaggctttctcc
acatgtgcatcccacctcacagtggtggttgtacattatggctttgcttctgtcatttac
ctcaagcctaagggccccaagtctctggaaggagatactctgatgggcatcacctacaca
gtcctcacccccttccttagtcccatcatcttcagtctcaggaacaaggagctaaagaat
gccatgaagaagatcttcctaagtaaactctatccagagaaaatttaa

DBGET integrated database retrieval system