KEGG   Mus musculus (mouse): 100038882
Entry
100038882         CDS       T01002                                 

Gene name
Isg15, G1p, G1p2, IGI15, IP17, Irfp, UCRP
Definition
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100038882 (Isg15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100038882 (Isg15)
   05169 Epstein-Barr virus infection
    100038882 (Isg15)
   05165 Human papillomavirus infection
    100038882 (Isg15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    100038882 (Isg15)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100038882 (Isg15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD UN_NPL4 Ubiquitin_2 Ubiquitin_4 Crinkler DUF2407 RAWUL
Other DBs
NCBI-GeneID: 100038882
NCBI-ProteinID: NP_056598
MGI: 1855694
Ensembl: ENSMUSG00000035692
UniProt: Q64339 Q4FJR9
Structure
PDB: 

Position
4 E2; 4
AA seq 161 aa
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcctgggacctaaaggtgaagatgctggggggtaacgatttcctggtgtccgtgact
aactccatgacggtgtcagaactgaagaagcagattgcccagaagattggtgtgccggct
ttccagcagcgcctggcccaccaaactgcagtgctccaggacggtcttaccctttccagt
ctgggtctgggtcccagcagcacagtgatgctagtggtacagaactgcagcgagcctctg
agcatcctggtgaggaacgaaaggggccacagcaacatctatgaggtctttctgacgcag
actgtagacacgcttaagaagaaggtgtcccagcgggaacaagtccacgaagaccagttc
tggctgagcttcgagggaaggcccatggaggacaaggagctgctgggggagtatggccta
aagccccagtgcacagtgatcaagcatttgcgcctgaggggtgggggaggggaccagtgt
gcctaa

DBGET integrated database retrieval system