KEGG   Mus musculus (mouse): 100038909
Entry
100038909         CDS       T01002                                 

Gene name
Gm14548
Definition
(RefSeq) predicted gene 14548
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    100038909 (Gm14548)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100038909 (Gm14548)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    100038909 (Gm14548)
CD molecules [BR:mmu04090]
 Proteins
  100038909 (Gm14548)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Izumo-Ig DUF5011 Lamp
Other DBs
NCBI-GeneID: 100038909
NCBI-ProteinID: NP_001160144
MGI: 3709645
Ensembl: ENSMUSG00000074417
Vega: OTTMUSG00000017169
UniProt: E9Q1Z6
Position
7; 7 A1
AA seq 680 aa
MSCTFTARLCLGLTLSLWIPVLTGSLPKPILRVQPHSVVSRRTKVTFLCEETIGANEYHL
YKDGKLYKTVTKNKQKPANKAEFSLSNVDLSNAGQYRCSYNTQDESSGYSDPLELVVTGD
YWTPSLSAQASPVVTSGGYVTLQCESWHNNHRFILTVEGPQKLSWMQDSQYNNSTRKYHA
LFSVGPVTPNQRWIFRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKR
AMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQQPGNKGKFFIPSVTQQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKK
FTSSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYYKNAPQLWSVPSALQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSGTIESSTWPPKRPIPPIPTENQDHTMENLIRMGMAVLVLIVL
SILATEAWRSHRQTHPVAGN
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagcccggctctgccttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccacactctgtggtctcc
agaaggactaaggtgaccttcttgtgtgaggagacaattggagccaatgagtaccacctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcactctcaaatgtagacctgagtaatgcaggtcaatatcgatgttcctac
aacacccaggatgaatcatcaggctacagtgaccccctggagctggtggtgacaggagac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacaatcacaggttcattctgactgtagaaggacca
cagaagctctcatggatgcaagactcacaatataacaactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagcgatggatattcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggatctgtgatcacctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacacagagcacacagaccctacagcagcctgggaacaagggcaagttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatac
tatgaacccaggctgtcagtactgcccagccctgtggtgacagcaggagggaacatgaca
ctccactgtgcctcagactttcactacgataaattcattctcaccaaggaagataagaaa
ttcaccagctcactggacacagagcatatatcttctagtagacagtaccgagccctgttt
attataggacccacaaccccaacccacacagggacattcagatgttatggttactacaag
aatgccccacagctgtggtcagtacctagtgctcttcaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgttactctgacatcaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgcagcctaaccacacagtgcactcaggagagaccgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatca
gcccagcaacccctgcgactaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcaggaacc
attgaatcctccacctggcctcccaaaaggcccatcccaccaattcccacagagaaccag
gatcacacaatggagaatctcatcaggatggggatggcagtcctggtcctcatcgtcctt
tcgattctagccactgaggcttggcgaagccatagacagacccaccctgtagctgggaac
taa

KEGG   Mus musculus (mouse): 100041146
Entry
100041146         CDS       T01002                                 

Gene name
Gm15448
Definition
(RefSeq) predicted gene 15448
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    100041146 (Gm15448)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100041146 (Gm15448)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    100041146 (Gm15448)
CD molecules [BR:mmu04090]
 Proteins
  100041146 (Gm15448)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Ig_6 Lamp
Other DBs
NCBI-GeneID: 100041146
NCBI-ProteinID: XP_003084730
MGI: 3705216
Ensembl: ENSMUSG00000074419
Vega: OTTMUSG00000022068
UniProt: F6PZL4
Position
7; 7 A1
AA seq 682 aa
MSCTFTARLCLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRWTKVTFLCEETIGANEYRL
YKDGKLYKTVTKNKQKPANKAEFSFSNVDLSNAGQYECSYSTQYKSSGYSDLLELVVTED
YWTPSLSAQASPVVTSGGYVTLQCESSQSYHRFILTVEGPQNLIWRQDSQYNYSTRKYHA
LFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPSSVITSER
AMTIWCQGNLDAEVYFLHNEKSQKTESTQTLQQPGNKGKFFIPSVTQQHAGQYRCYCYSS
AGWSEPSDTLELVVTGIYEHYELRLSALPSTVVTAGGNMTLHCASHSHYDKFILMKEDKK
FTNSLDTVYISSSRQYQALFIIGPTTPTHTGTFRCYGYYKNAPQLWSVPSDLQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSMANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSDPVDVLILIPGQLPITPSLLVKPNHTVHSGE
TVSLLCWSMDPVETFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGA
QDSSFYLLSSASSPVELTVSGTIESSTWSPKRPIPPIPTENQDHTTENLIRMGMAVVVLI
VLSILATEAWRSHRQTHPAAGN
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagcccggctctgtcttggactcactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtctcc
aggtggactaaggtgaccttcttgtgtgaagagacaattggagccaatgagtaccgcctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcattctcaaatgtagacctgagtaatgcaggtcaatatgaatgttcctac
agcacccagtataaatcatcaggctacagtgacctcctggagctggtggtgacagaagac
tactggacacccagcctttcagcccaggccagcccagtggtaacttcaggagggtatgtc
accctccagtgtgagtcctcgcagagctatcacaggttcattttgactgtagaaggacca
cagaatctcatatggagacaagactcacagtataactactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagagatggatatgcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaagctctgtgatcacctccgaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacagaaagcacacagaccctacagcagcctgggaacaagggcaagttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcagagcccagtgacaccctggagctggtggtgacaggaatctatgaacac
tatgaactcagactgtcagcactgcccagcactgtggtgacagcaggaggaaacatgaca
ctccactgtgcctcacacagtcactatgataaattcattctcatgaaggaagataagaaa
ttcaccaactcactggacacagtttatatatcttctagtagacagtaccaagccctgttt
attataggacccacaaccccaacccacacagggacattcagatgttacggttactacaag
aatgcaccacagctgtggtcagtacctagtgatctccaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatcaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctatggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctttcctctgagtggtcagcctctagtgaccccgtggacgtcctgatcctgatcccagga
cagctccctatcactccttccctcttagtgaagcctaaccacacagtgcactcaggagag
accgtgagcctgctgtgttggtcaatggaccctgtggagactttcattctgtccaaggag
ggatcagcccagcaacccctgcgactaaaatcgaagtcccatgatcagcagtcccaggca
gaattctccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagct
caagactcatctttctacctcttgtcatctgccagttcccctgtggagctcacagtctca
ggaaccattgaatcctccacctggtctcccaaaaggcccatcccaccaattcccacagag
aaccaggatcacacaacagagaatctgatcaggatggggatggcagtcgtggtcctcata
gtcctttcgattctagccactgaggcttggcgaagccatagacagacccaccctgcagct
gggaactaa

KEGG   Mus musculus (mouse): 14728
Entry
14728             CDS       T01002                                 

Gene name
Lilrb4a, CD85K, Gp49b, HM18, IL, ILT3, LIR-5, Li, Lilrb4, gp49
Definition
(RefSeq) leukocyte immunoglobulin-like receptor, subfamily B, member 4A
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    14728 (Lilrb4a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14728 (Lilrb4a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14728 (Lilrb4a)
CD molecules [BR:mmu04090]
 Proteins
  14728 (Lilrb4a)
SSDB
Motif
Pfam: Ig_2 ig Ig_3 DUF6377 OAD_gamma Tissue_fac
Other DBs
NCBI-GeneID: 14728
NCBI-ProteinID: NP_038560
MGI: 102701
Ensembl: ENSMUSG00000062593 ENSMUSG00000112148
UniProt: Q64281
Position
10 B3; 10 25.5 cM
AA seq 335 aa
MIAMLTVLLYLGLILEPRTAVQAGHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHL
YKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGA
YENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYAT
FVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKIL
IGVLVSFLLLFFLLLFLILIGYQYGHKKKANASVKNTQSENNAELNSWNPQNEDPQGIVY
AQVKPSRLQKDTACKETQDVTYAQLCIRTQEQNNS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgatcgccatgctcacagtgctgctataccttggtcttattctggaacccaggactgca
gtacaggcaggacacctcccaaagcccatcatctgggctgagccaggctctgtgatcgct
gcgtatacatctgtgattacctggtgtcagggttcctgggaggcccagtattatcatctg
tataaagagaaaagtgtaaatccttgggacactcaagtccctctggaaaccaggaataag
gccaagttcaacattccaagcatgacaacctcatatgcaggcatatataagtgttactat
gagagtgctgctggcttctcagagcacagtgatgccatggagctggtgatgacaggagca
tatgaaaatcccagcctgtcagtctatcccagctctaatgtgacctctggagtttccata
tcctttagttgcagctcatccatagtatttggcagattcattctgatccaggaaggaaag
catggcctctcttggaccctggactcacagcatcaggccaatcagccatcctatgctact
tttgttctggatgctgttactcccaaccacaatggaacattcagatgctatggctacttt
agaaatgaaccacaggtgtggtcaaaaccaagtaactccctagacctcatgatctcagaa
accaaggaccagtcctctacacccactgaagatggactggaaacataccagaagattttg
attggagtcctggtgtcattcctcctgcttttcttcctcctgctttttctcatcctcatc
ggataccagtatgggcacaaaaagaaggctaatgcttctgtgaagaacacacaatctgag
aacaatgcagagctgaacagttggaacccacaaaatgaagacccccagggaattgtctac
gcccaggtaaaaccctccaggcttcagaaggacactgcatgcaaagagacccaggatgta
acctatgcccagttgtgcatcaggacacaggaacagaacaacagctga

KEGG   Mus musculus (mouse): 18722
Entry
18722             CDS       T01002                                 

Gene name
Pira1, 6M21, Ly8, Ly89, PI, PIR-A1, Pir
Definition
(RefSeq) paired-Ig-like receptor A1
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18722 (Pira1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18722 (Pira1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18722 (Pira1)
CD molecules [BR:mmu04090]
 Proteins
  18722 (Pira1)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig Ig_6 Izumo-Ig DUF5011 DUF6299
Other DBs
NCBI-GeneID: 18722
NCBI-ProteinID: NP_001357997
MGI: 1195971
Ensembl: ENSMUSG00000081665
Vega: OTTMUSG00000027884
Position
7 A1; 7 2.15 cM
AA seq 585 aa
MSCTFTALLCLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRRTKVTFFCEETIGANEYHL
YKDGKLYKTVTKNKQKPANKAEFSFSNVDLRNAGQYRCSYSTQDESSGYSDLLELVVTED
YWTPSLSAQASPVVTSGGYVTLQCESWPSYDRFILTVAGPQKFSWTQDSQYNYSTRKNHA
LFSVGPVTPNQRWIFRCYSYDRNRPYVFSAPSESVELLVSGIYEYYEPRLSVLPSPVVTA
GGNMTLHCASDFHYDKFILTKEDKKFTSSLDTEHISSSRQYRALFIIGPTTPTHTGTFRC
YGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHTMDPGMTLTLQCFSDINYDRYAL
HKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDIL
ITGQLPLTPSLSVKPNHTVHSGETVSLLCWSMDPVDTFILSKEGSAQQPLRLKSKSHDQQ
SQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSETIESSTWSPKRPIPPI
PTENKDHTMENLIRMGMAVLVLIVLSILATEAWRSHRQTHPAAGN
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctctgtcttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtctcc
aggaggactaaggtgactttcttttgtgaggagacaattggagccaatgagtaccacctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcattctcaaatgtagacctgagaaatgcaggtcaatatcgatgttcctac
agcacccaggatgaatcatcaggctacagtgacctcctggagctggtggtgacagaagac
tactggacacccagcctttcagcccaggccagcccagtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggccgagctatgacaggttcattttgactgtagcaggacca
cagaagttctcatggacacaagactcacagtataactactctacacggaagaaccacgcc
ctgttctctgtgggccctgtgacccccaaccagagatggatattcagatgttacagttat
gacaggaatagaccatatgtgttctcagctccaagtgaatccgtggagctcctggtctca
ggaatctatgaatactatgaacccaggctgtcagtactgcccagccctgtggtgacagca
ggagggaacatgacactccactgtgcctcagactttcactacgataaattcattctcacc
aaggaagataagaaattcaccagctcactggacacagagcatatatcttctagtagacag
taccgagccctgtttattataggacccacaaccccaacccacacagggacattcagatgt
tatggttactacaagaatgccccacagctgtggtcagtacctagtgctcttcaacaaata
ctcatctcagggctgtccaagaagccctctctgctgactcaccaaggccataccatggac
cctggaatgaccctcaccctgcagtgtttctctgacatcaactatgacagatatgctctg
cacaaggtggggggagctgacatcatgcagcactctagccagcagactgacactggcttc
tctgtggccaacttcacactgggctatgtgagtagctccactggaggccaatacagatgc
tatggtgcacacaacctctcctctgagtggtcagcctccagtgagcccctggacatcctg
atcacaggacagctccctctcactccttccctctcagtgaagcctaaccacacagtgcac
tcaggagagaccgtgagcctgctgtgttggtcaatggaccctgtggatactttcattctg
tccaaggagggatcagcccagcaacccctgcgactaaaatcgaagtcccatgatcagcag
tcccaggcagaattctccatgagtgctgtgacctcccatctctcaggcacctacaggtgc
tatggagctcaagactcatctttctacctcttgtcatctgccagtgcccctgtggagctc
acagtctcagaaaccattgaatcctccacctggtctcccaaaaggcccatcccaccaatt
cccacagagaacaaggatcacacaatggagaatctcatcaggatggggatggcagtcctg
gtcctcatcgtcctttcgattctagccactgaggcttggcgaagccatagacagacccac
cctgcagctgggaactaa

KEGG   Mus musculus (mouse): 18724
Entry
18724             CDS       T01002                                 

Gene name
Pira11, Gm14548, p91, p91C
Definition
(RefSeq) paired-Ig-like receptor A11
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18724 (Pira11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18724 (Pira11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18724 (Pira11)
CD molecules [BR:mmu04090]
 Proteins
  18724 (Pira11)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Izumo-Ig DUF5011
Other DBs
NCBI-GeneID: 18724
NCBI-ProteinID: NP_035218
MGI: 1276541
UniProt: Q3ZB54
Position
7; 7 A1
AA seq 680 aa
MSCTFTARLCLGLTLSLWIPVLTGSLPKPILRVQPHSVVSRRTKVTFLCEETIGANEYHL
YKDGKLYKTVTKNKQKPANKAEFSLSNVDLSNAGQYRCSYNTQDESSGYSDPLELVVTGD
YWTPSLSAQASPVVTSGGYVTLQCESWHNNHRFILTVEGPQKLSWMQDSQYNNSTRKYHA
LFSVGPVTPNQRWIFRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVIASKR
AMTIWCQGNLDAEVYFLHNEGSQKTQSTQTLQQPGNKGRFFIPSVTQQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEHYKPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKK
FGNSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYFKNAPQLWSVPSDLQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNHTVHSGETV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSETIESSTWSPKRPIPPIPTENKDHTMENLIRMGMAVLVLIVL
SILATEAWRSHRQTHPAAGN
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagcccggctctgccttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccacactctgtggtctcc
agaaggactaaggtgaccttcttgtgtgaggagacaattggagccaatgagtaccacctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcactctcaaatgtagacctgagtaatgcaggtcaatatcgatgttcctac
aacacccaggatgaatcatcaggctacagtgaccccctggagctggtggtgacaggagac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacaatcacaggttcattctgactgtagaaggacca
cagaagctctcatggatgcaagactcacaatataacaactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagcgatggatattcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggatctgtgatcgcctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
ggaagccaaaaaacacagagcacacagaccctacagcagcctgggaacaagggcaggttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaacac
tataaacccaggctgtcagtactgcccagccctgtggtgacagcaggaggaaacatgaca
ctccactgtgcctcagactttcactacgataaattcattctcaccaaggaagataagaaa
ttcggcaactcactggacacagagcatatatcttctagtagacagtaccgagccctgttt
attataggacccacaaccccaacccatacagggacattcagatgttatggttacttcaag
aatgccccacagctgtggtcagtacctagtgatctccaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatcaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctttcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgaagcctaaccacacagtgcactcaggagagaccgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatca
gcccagcaacccctacgactaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggtgctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagaaacc
attgaatcctccacctggtctcccaaaaggcccatcccaccaattcccacagagaacaag
gatcacacaatggagaatctcatcaggatggggatggcagtcctggtcctcatcgtcctt
tcgattctagccactgaggcttggcgaagccatagacagacccaccctgcagctgggaac
taa

KEGG   Mus musculus (mouse): 18725
Entry
18725             CDS       T01002                                 

Gene name
Pira2, 6M23
Definition
(RefSeq) paired-Ig-like receptor A2
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18725 (Pira2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18725 (Pira2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18725 (Pira2)
CD molecules [BR:mmu04090]
 Proteins
  18725 (Pira2)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Ig_6
Other DBs
NCBI-GeneID: 18725
NCBI-ProteinID: NP_001366618
MGI: 1195970
Ensembl: ENSMUSG00000089942
Vega: OTTMUSG00000027892
Position
7; 7 A1
AA seq 679 aa
MSCTFTALLCLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRL
YKDGKLYKTVTKNKQKPANKAEFSFSNVDLSNAGQYECSYSTQYKSSGYSDPLKLVVTDY
WTPSLSAQASPVVTSGGYVTLQCESWPSYDRFILTVAGPQKFSWTQDSQYNYSTRKNHAL
FSVGPVTPNQRWIFRCYSYDRNRPYVFSAPSESVELLVSGNLQKPTIKAEPGSVITSKRA
MTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGRFFIPSVTQQHAGQYRCYCYSSA
GWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKKF
TSSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYYKNAPQLWSVPSALQQILISGLS
KKPSLLTHQGHTLDPGMTLTLQCFSDINYDRYALHKVGRADIMQHSSQQTDTGFSVANFT
LGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVS
LLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDS
SFYLLSSASAPVELTVSETIESSTWSPKRPIPPIPTENKDHTMENLIRMGMAVLVLIVLS
ILATEAWRSHRQTHPAAGN
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctctgtcttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtctcc
aggaggactaaggtgaccttcttgtgtgaggagacaattggagccaatgagtaccgcctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcattctcaaatgtagacctgagtaatgcaggtcaatatgaatgttcctac
agcacccagtataaatcatcaggctacagtgaccccctgaagctggtggtgacagactac
tggacacccagcctttcagcccaggccagcccagtggtaacttcaggagggtatgtcacc
ctccagtgtgagtcctggccgagctatgacaggttcattttgactgtagcaggaccacag
aagttctcatggacacaagactcacagtataactactctacacggaagaaccacgccctg
ttctctgtgggccctgtgacccccaaccagagatggatattcagatgttacagttatgac
aggaatagaccatatgtgttctcagctccaagtgaatccgtggagctcctggtctcaggt
aatctccaaaaaccaaccatcaaggctgaaccaggatctgtgatcacctccaaaagagca
atgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgagaaa
agccaaaaaacacagagcacacagaccctacaggagcctgggaacaagggcaggttcttc
atcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctcagct
ggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatactat
gaacccaggctgtcagtactgcccagccctgtggtgacagcaggagggaacatgacactc
cactgtgcctcagactttcactacgataaattcattctcaccaaggaagataagaaattc
accagctcactggacacagagcatatatcttctagtagacagtaccgagccctgtttatt
ataggacccacaaccccaacccacacagggacattcagatgttatggttactacaagaat
gccccacagctgtggtcagtacctagtgctcttcaacaaatactcatctcagggctgtcc
aagaagccctctctgctgactcaccaaggccataccctggaccctggaatgaccctcacc
ctgcagtgtttctctgacatcaactatgacagatatgctctgcacaaggtggggagagct
gacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttcaca
ctgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaacctc
tcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctccct
ctcactccttccctctcagtgcagcctaaccacacagtgcactcaggagagaccgtgagc
ctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatcagcc
cagcaacccctgcgactaaaatcaaagtcccatgatcagcagtcccaggcagaattctcc
atgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagctcaagactca
tctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagaaaccatt
gaatcctccacctggtctcccaaaaggcccatcccaccaattcccacagagaacaaggat
cacacaatggagaatctcatcaggatggggatggcagtcctggtcctcatcgtcctttcg
attctagccactgaggcttggcgaagccatagacagacccaccctgcagctgggaactaa

KEGG   Mus musculus (mouse): 18726
Entry
18726             CDS       T01002                                 

Gene name
Lilra6, 7M1, P, Pira3
Definition
(RefSeq) leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18726 (Lilra6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18726 (Lilra6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18726 (Lilra6)
CD molecules [BR:mmu04090]
 Proteins
  18726 (Lilra6)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Izumo-Ig Ig_6 Lamp
Other DBs
NCBI-GeneID: 18726
NCBI-ProteinID: NP_035220
MGI: 1195969
Ensembl: ENSMUSG00000030427
Vega: OTTMUSG00000021305
UniProt: A0A0B4J1F3
Position
7; 7 A1
AA seq 663 aa
MSCTFTALLCLGLTLRLWIPVLTGSLPKPILRVQPDSVVQVWTKVTFLCEETIGANEYRL
YKDGKLYKTVTKNKQKPANKAEFSFSNVHLRNAGQYRCSYNTQDESSGYSDPLVLVVTGH
YWTPSLSAQASPVVTSGGYVTLQCESSQSYHRFILTVEGQQKVSWTQDSQYNISTGKYHA
LFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKTTIKAEPGSVIASKR
AMTIWCQGNLDAEVYFLHNERSQKTQSTQTLQEPGNKGKFFIPSVRRQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEHYEPRLSALPSPVVTAGGKMTLHCASHGHYDKFILTKEDKK
FTSSQDTEHISSSRQYRALFIIGPTTPTHTGAFRCYGYYKNTPLLWSVPSALQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCYSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVSSYTGGQYRCYGAHNLSSEWSASSDPLDILISGQLPLTPSLSVQPNHTVHSGETV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSATENQDHTTENLIRMGMAVVVLIVLSILATEAWQSHRQTHPA
AGN
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctctgtcttggactgactctgaggctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtccaa
gtgtggactaaggtgaccttcttgtgtgaagagacaattggagccaatgagtaccgcctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcattctcaaatgtacacctgagaaatgcaggtcaatatcgatgttcctac
aacacccaggatgaatcatcaggctacagtgaccccctggtgctagtagtgacaggacac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
actctccagtgtgagtcttcgcagagctatcacaggttcattttaactgtagaaggacag
cagaaggtctcatggacacaagactcacagtataacatctctacagggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagagatggatatgcagatgctacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaaccaccatcaaagctgaaccaggctctgtgatcgcctccaagaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
agaagccaaaaaacacagagcacacagaccctacaggagcctgggaacaagggcaagttc
ttcatcccttctgtgagacgacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaacac
tatgaacccaggctctcagcactgcccagccctgtggtgacagcaggagggaagatgaca
ctccactgtgcctcacatggtcactatgataaattcattctcaccaaggaagataagaaa
ttcaccagctcacaggacacagagcatatatcttctagtagacagtacagagccctgttt
attataggacccacaaccccaacccatacaggggcattcagatgttatggttactacaag
aataccccattactgtggtcagtacctagtgctctccaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgttactctgacatcaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acacttggctatgtgagtagctacactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgaccccctggacatcctgatctcaggacagctc
cctctcactccttccctctcagtgcagcctaaccacacagtgcactcaggagagaccgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatca
gcccagcaacccctgcgactaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggtgctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagccaca
gagaaccaggatcacacaacggagaatctgatcaggatggggatggcagtcgtggtcctc
atcgtcctttcgattctagccactgaggcttggcaaagccatagacagacccaccctgca
gctggaaactaa

KEGG   Mus musculus (mouse): 18727
Entry
18727             CDS       T01002                                 

Gene name
Pira4, 6M7
Definition
(RefSeq) paired-Ig-like receptor A4
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18727 (Pira4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18727 (Pira4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18727 (Pira4)
CD molecules [BR:mmu04090]
 Proteins
  18727 (Pira4)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Izumo-Ig DUF5011 Lamp
Other DBs
NCBI-GeneID: 18727
NCBI-ProteinID: NP_035221
MGI: 1195988
UniProt: A2NTK1
Position
7; 7 A1
AA seq 680 aa
MSCTFTALLCLGLTLSLWIPVLTGSLPKPILRVQPHSVVSRRTKVTFLCEETIGANEYHL
YKDGKLYKTVTKNKQKPANKAEFSLSNVDLSNAGQYRCSYNTQDESSGYSDPLELVVTGD
YWTPSLSAQASPVVTSGGYVTLQCESWHNNHRFILTVEGPQKLSWMQDSQYNNSTRKYHA
LFSVGPVTPNQRWIFRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKR
AMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGRFFIPSVTQQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKK
FTSSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYYKNTPQLWSVPSALQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCFSDINYDRYALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVRSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNYTVQSGENV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSETIESSTWSPKRPIPPIPTENKDHTMENLIRMGMAVLVLIVL
SILATEAWRSHRQTHPAAGN
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctctgccttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccacactctgtggtctcc
agaaggactaaggtgaccttcttgtgtgaggagacaattggagccaatgagtaccacctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcactctcaaatgtagacctgagtaatgcaggtcaatatcgatgttcctac
aacacccaggatgaatcatcaggctacagtgaccccctggagctggtggtgacaggagac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacaatcacaggttcattctgactgtagaaggacca
cagaagctctcatggatgcaagactcacaatataacaactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagcgatggatattcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggtcctgtgatcgcctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacacagagcacacagaccctacaggagcctgggaacaagggcaggttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatac
tatgaacccaggctgtcagtactgcccagccctgtggtgacagcaggagggaacatgaca
ctccactgtgcctcagactttcactacgataaattcattctcaccaaggaagataagaaa
ttcaccagctcactggacacagagcatatatcctctagtagacagtaccgagccctgttt
attataggacccacaaccccaacccacacagggacattcagatgttatggttactacaag
aataccccacagctgtggtcagtacctagtgctcttcaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatcaactatgacagatatgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acactgggctatgtgcgtagctccactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgaagcctaactacacagtgcagtcaggagagaacgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatcg
gcccagcaacccctgcgattaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagaaacc
attgaatcctccacctggtctcccaaaaggcccatcccaccaattcccacagagaacaag
gatcacacaatggagaatctcatcaggatggggatggcagtcctggtcctcatcgtcctt
tcgattctagccactgaggcttggcgaagccatagacagacccaccctgcagctgggaac
taa

KEGG   Mus musculus (mouse): 18729
Entry
18729             CDS       T01002                                 

Gene name
Pira6, 12M1, Pi, Pira10, p91, p91B
Definition
(RefSeq) paired-Ig-like receptor A6
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18729 (Pira6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18729 (Pira6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18729 (Pira6)
CD molecules [BR:mmu04090]
 Proteins
  18729 (Pira6)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Ig_6 DUF5011 Lamp
Other DBs
NCBI-GeneID: 18729
NCBI-ProteinID: NP_001276357
MGI: 1195974
Position
7; 7 A1
AA seq 663 aa
MSCTFTALLCLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRRTNVTFFCEETIGANEYRL
YKDGKLYKTVTKNKQKQANKAEFSFSNVDLSNAGQYECSYSTQDESSGYSDPLELVVTGH
YWTPSLSAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHA
LFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKR
AMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQQPGNKGRFFIPSVTQQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEYNEPRLSLLPSPVVRPGGNMTLHCASQGHYDKFILTKEDKK
FANALDTEHISSSRQYQALFIIGPTTPTHTGTFRCYGYYKNTPQLWSVPSNLQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCFSDMNYDRFALHKVGGADIMQHSSQQTDIGFSVANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSATENQDHTMENLIRMGMAVVVFIVLSILATEAWRSHRQTHCA
AGN
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctctgtcttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtctcc
aggaggactaatgtgaccttcttctgtgaggagacaattggagccaatgagtaccgcctc
tataaagatggaaagctatataaaactgtaacaaagaacaaacagaagcaagcaaacaag
gccgaattctcattctcaaatgtagacctgagtaatgcaggtcaatatgaatgttcctac
agcacccaggatgaatcatcaggctacagtgaccccctggagctggtggtgacaggacac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacgatcacaagttcattctgactgtagaaggacca
cagaagctctcatggacacaagactcacagtataactactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagagatggatatgcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggatctgtgatcacctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacacagagcacacagaccctacagcagcctgggaacaagggcaggttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatac
aatgaacccaggctgtcattactgcccagccctgtggtgagaccaggagggaacatgaca
ctccactgtgcctcacaaggtcactatgataaattcattctcaccaaggaagataagaaa
ttcgccaacgccctggacacagagcatatatcttctagtagacagtaccaagccctgttt
attataggacccacaaccccaacacatacagggacattcagatgttatggttactacaag
aataccccacagctgtggtcagtacctagtaatctccaacaaatcctcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatgaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacattggcttttctgtggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgcagcctaaccacacagtgcactcaggagagaccgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatca
gcccagcaacccctgagactaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggtgctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagccaca
gagaaccaggatcacacaatggagaatctcatcaggatggggatggcagtcgtggtcttc
atcgtcctttcgattctagccactgaggcttggcgaagccatagacagacccactgtgca
gctgggaactaa

KEGG   Mus musculus (mouse): 18730
Entry
18730             CDS       T01002                                 

Gene name
Pira7, 16M2
Definition
(RefSeq) paired-Ig-like receptor A7
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18730 (Pira7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18730 (Pira7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18730 (Pira7)
CD molecules [BR:mmu04090]
 Proteins
  18730 (Pira7)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set V-set Izumo-Ig DUF5011 Lamp
Other DBs
NCBI-GeneID: 18730
NCBI-ProteinID: NP_035224
MGI: 1195973
UniProt: A2NTK4
Position
7
AA seq 680 aa
MSCTFTARLCLGLTLSLWIPVLTGSLPKPILRVQPHSVVSRRTKVTFLCEETIGANEYHL
YKDGKLYKTVTKNKQKPANKAEFSLSNVDLSNAGQYRCSYNTQDESSGYSDPLELVVTGD
YWTPSLSAQASPVVTSGGYVTLQCESWHNNHRFILTVEGPQKLSWMQDSQYNNSTRKYHA
LFSVGPVTPNQRWIFRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGPVIASKR
AMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGRFFIPSVTQQHAGQYRCYCYSS
AGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFHYDKFILTKEDKK
FTSSLDTEHISSSRQYRALFIIGPTTPTHTGTFRCYGYYKNTPQLWSVPSALQQILISGL
SKKTSLLTHQGHILDPGMTLTLQCFSDINYDRYALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVKPNYTVHSGENV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSETIESSTWSPKRPIPPIPTENKDHTMENLIRMGMAVLVLIVL
SILATEAWRSHRQTHPAAGN
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagcccggctctgccttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccacactctgtggtctcc
agaaggactaaggtgaccttcttgtgtgaggagacaattggagccaatgagtaccacctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagcaaacaag
gctgaattctcactctcaaatgtagacctgagtaatgcaggtcaatatcgatgttcctac
aacacccaggatgaatcatcaggctacagtgaccccctggagctggtggtgacaggagac
tactggacacccagcctttcagcccaggccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacaatcacaggttcattctgactgtagaaggacca
cagaagctctcatggatgcaagactcacaatataacaactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagcgatggatattcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggtcctgtgatcgcctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacacagagcacacagaccctacaggagcctgggaacaagggcaggttc
ttcatcccttctgtgacacaacaacatgcagggcaatatcgctgttattgttacagctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatac
tatgaacccaggctgtcagtactgcccagccctgtggtgacagcaggagggaacatgaca
ctccactgtgcctcagactttcactacgataaattcattctcaccaaggaagataagaaa
ttcaccagctcactggacacagagcatatatcctctagtagacagtaccgagccctgttt
attataggacccacaaccccaacccacacagggacattcagatgttatggttactacaag
aataccccacagctgtggtcagtacctagtgctcttcaacaaatactcatctcagggctg
tccaagaagacctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatcaactatgacagatatgctctgcacaaggtggggggg
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgaagcctaactacacagtgcactcaggagagaacgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatcg
gcccagcaacccctgcgattaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcagaaacc
attgaatcctccacctggtctcccaaaaggcccatcccaccaattcccacagagaacaag
gatcacacaatggagaatctcatcaggatggggatggcagtcctggtcctcatcgtcctt
tcgattctagccactgaggcttggcgaagccatagacagacccaccctgcagctgggaac
taa

KEGG   Mus musculus (mouse): 18733
Entry
18733             CDS       T01002                                 

Gene name
Pirb, Gp9, Gp91, LIR-3, Li, Lilrb3, PIR-B
Definition
(RefSeq) paired Ig-like receptor B
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    18733 (Pirb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18733 (Pirb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18733 (Pirb)
CD molecules [BR:mmu04090]
 Proteins
  18733 (Pirb)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set V-set Ig_6 DUF4985
Other DBs
NCBI-GeneID: 18733
NCBI-ProteinID: NP_035225
MGI: 894311
Ensembl: ENSMUSG00000058818
Vega: OTTMUSG00000020499
UniProt: P97484
Structure
PDB: 
6GRQ 6GRS 6GRT

Position
7 A1; 7 2.14 cM
AA seq 841 aa
MSCTFTALLRLGLTLSLWIPVLTGSLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRL
YKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGH
YWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHA
LFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKR
AMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGS
AGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKK
FGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGL
SKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANF
TLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETV
SLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQD
SSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLKALIGVSVAFILFLFIFIF
ILLRRRHRGKFRKDVQKEKDLQLSSGAEEPITRKGELQKRPNPAAATQEESLYASVEDMQ
TEDGVELNSWTPPEEDPQGETYAQVKPSRLRKAGHVSPSVMSREQLNTEYEQAEEGQGAN
NQAAESGESQDVTYAQLCSRTLRQGAAASPLSQAGEAPEEPSVYATLAAARPEAVPKDME
Q
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtcctgcaccttcacagccctgctccgtcttggactgactctgagcctctggatccca
gtgctgacagggtccctccctaagcctatcctcagagtacagccagactctgtggtctcc
aggaggactaaggtgaccttcttgtgtgaagagacaattggagccaatgagtaccgcctc
tataaagatggaaagctatataaaaccgtaacaaagaacaaacagaagccagaaaacaag
gctgaattctcattctcaaatgtagacctgagtaatgcaggtcaatatcgatgttcctac
agcacccagtataaatcatcaggctacagtgacctcctggagctggtggtgacaggacac
tactggacacccagccttttagcccaagccagccctgtggtaacttcaggagggtatgtc
accctccagtgtgagtcctggcacaacgatcacaagttcattctgactgtagaaggacca
cagaagctctcgtggacacaagactcacagtataattactctacaaggaagtaccacgcc
ctgttctctgtgggccctgtgacccccaaccagagatggatatgcagatgttacagttat
gacaggaacagaccatatgtgtggtcacctccaagtgaatccgtggagctcctggtctca
ggtaatctccaaaaaccaaccatcaaggctgaaccaggatctgtgatcacctccaaaaga
gcaatgaccatctggtgtcaggggaacctggatgcagaagtatattttctgcataatgag
aaaagccaaaaaacacagagcacacagaccctacaggagcctgggaacaagggcaagttc
ttcatcccttctgtgacactacaacatgcagggcaatatcgctgttattgttacggctca
gctggttggtcacagcccagtgacaccctggagctggtggtgacaggaatctatgaatac
tatgaacccaggctgtcagtactgcccagccctgtggtgacagctggagggaacatgaca
ctccactgtgcctcagactttccctacgataaattcattctcaccaaggaagataagaaa
ttcggcaactcactggacacagagcatatatcttctagtggacagtaccgagccctgttt
attataggacccacaaccccaacccatacaggggcattcagatgttacggttactacaag
aatgccccacagctgtggtcagtacctagtgctctccaacaaatactcatctcagggctg
tccaagaagccctctctgctgactcaccaaggccatatcctggaccctggaatgaccctc
accctgcagtgtttctctgacatcaactatgacagatttgctctgcacaaggtgggggga
gctgacatcatgcagcactctagccagcagactgacactggcttctctgtggccaacttc
acactgggctatgtgagtagctccactggaggccaatacagatgctatggtgcacacaac
ctctcctctgagtggtcagcctccagtgagcccctggacatcctgatcacaggacagctc
cctctcactccttccctctcagtgcagcctaaccacacagtgcactcaggagagaccgtg
agcctgctgtgttggtcaatggactctgtggatactttcattctgtccaaggagggatca
gcccagcaacccctgcgactaaaatcaaagtcccatgatcagcagtcccaggcagaattc
tccatgagtgctgtgacctcccatctctcaggcacctacaggtgctatggagctcaagac
tcatctttctacctcttgtcatctgccagtgcccctgtggagctcacagtctcaggaccc
atcgaaacctctaccccgccacccacaatgtccatgccactaggtggactgcatatgtac
ctgaaggctctcattggagtgtctgtggccttcatcctgttcctcttcatcttcatcttc
attcttcttcgacgaagacatcggggaaaattcaggaaagatgtccagaaagagaaagac
ttgcaactttcttcaggagctgaagagcccataaccaggaaaggagaactccagaagagg
cccaacccagctgctgccacccaggaagaaagcctatatgcttcagtggaggacatgcaa
actgaggatggagtggagctgaacagctggacaccacctgaggaagatccccagggagag
acttatgcccaggtgaaaccctccaggctcaggaaggcaggacatgtctcaccttctgtc
atgtcaagggaacaactgaacacagaatatgaacaagcagaagagggccaaggagcaaac
aatcaggctgccgaatctggggagtcccaggatgtgacctatgcccagctgtgcagcagg
acactcagacagggggcagctgcatctcctctctcccaggcaggggaagccccagaggag
cccagtgtatatgctactctggcggctgctcgtccagaggctgttcccaaggacatggag
caatga

KEGG   Mus musculus (mouse): 232790
Entry
232790            CDS       T01002                                 

Gene name
Oscar, mO, mOSCAR, mOSCAR-M1, mOSCAR-M2, mOSCAR-M3
Definition
(RefSeq) osteoclast associated receptor
  KO
K14377  osteoclast-associated immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    232790 (Oscar)
SSDB
Motif
Pfam: Ig_2 ig Ig_3 Ig_C19orf38
Other DBs
NCBI-GeneID: 232790
NCBI-ProteinID: NP_001277306
MGI: 2179720
Ensembl: ENSMUSG00000054594
Vega: OTTMUSG00000021060
UniProt: Q8VBT3
Position
7; 7 A1
AA seq 265 aa
MVLSLILQLSTLWPACRADFTPTAPLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWR
FALFKSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLEL
LVTDQLPRPSLVALPGPVVAPGANVSLRCAGRIPGMSFALYRVGVATPLQYIDSVQPWAD
FLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEGSGSLDYTQGNLIRLGLAGMVLI
CLGIIVTCDWHSRSSAFDGLLPQQN
NT seq 798 nt   +upstreamnt  +downstreamnt
atggtcctgtcgctgatactccagctgtcgactctctggcctgcatgccgtgctgacttc
acaccaacagcgcccctagcctcatacccccagccatggctgggagctcatcctgctgca
gttgtgactcctgggatcaacgtgaccttgacttgccgcgcacctcaatctgcctggcgg
tttgcactcttcaaaagtggccttgtcacccctctgctcctccgggatgtgtccgttgag
ctggctgagttcttcctggaagaagtgactccggcccaagggggcagttatcactgccgc
taccgcaagacagactgggggccaggtgtctggtctcagcccagtaatgttctggaactg
ctggtaacggatcagctccccagaccatcactggtggcactgcctgggcctgtggtggcc
ccgggagccaacgtaagcctgcgctgtgcaggccgcataccgggcatgagttttgcactg
taccgcgtaggcgtggcaacccctctgcagtatattgactctgtgcagccctgggctgac
ttccttttgatcggcacacacacacctggcacctactgttgctattaccacacgccttct
gccccctatgtgctatcacagcgcagccagccactggtcatcagtttcgaaggttctggc
tccttggactatacccagggaaacctcatccgtttggggctggcaggaatggtcctcatc
tgcttgggcatcatagttacttgtgattggcacagcaggagctctgcctttgatggtctc
ctgccccagcaaaactga

KEGG   Mus musculus (mouse): 232801
Entry
232801            CDS       T01002                                 

Gene name
Lilra5, E030017K20, EG232801, Gm4878, Lilrc1
Definition
(RefSeq) leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
  KO
K06512  leukocyte immunoglobulin-like receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    232801 (Lilra5)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    232801 (Lilra5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    232801 (Lilra5)
CD molecules [BR:mmu04090]
 Proteins
  232801 (Lilra5)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_C17orf99 HGWP
Other DBs
NCBI-GeneID: 232801
NCBI-ProteinID: NP_001074708
MGI: 3647196
Ensembl: ENSMUSG00000070873
Vega: OTTMUSG00000027903
UniProt: D3Z7A9
Position
7; 7 A1
AA seq 295 aa
MTFVFTAVLCLGLNLGQETSMSEGNPHKPTLSVQPGLVVAKGKQVTISCEVTTGAREYRL
YKEGGPHPWRTRNTPKTTNKAQFLIPSIEQRSGGIYRCYYKTPTGWSEHSDPLELAVTGL
YSKPSLSTQPSNVVNSGETVTLQCVSTLGFNRFVLTKEGEQKWSLIQESEFINSTGQFQG
LFTVGPVTPSQRWIFRCYGYHVNSPQVWSEPSDLLEIHVSEADQPLRPSPNISDPKTVSQ
PQNYTMENLIRMGASILVLVLLGVLLFEAQHSQRQTQHAAGRESSASFMVADTWE
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaccttcgtcttcacagctgtgctctgtctggggctgaatctgggccaagagacctcc
atgtcggaagggaatccgcacaagccaacccttagtgttcagccaggattggtggttgcc
aaagggaagcaggtgaccatctcatgtgaggtgaccacaggggcccgggaataccgtctt
tataaagaggggggtccacatccttggcgcacacggaacactccgaagaccacaaacaaa
gctcagttcttgatcccatcaattgaacaacgatctggggggatatatcgctgttactat
aagacccccactgggtggtcagagcacagtgaccctctagagcttgcagtgacaggactc
tatagtaaacccagcctgtccacccagcccagcaatgttgtgaattcaggggagactgta
acccttcagtgtgtctcaacactgggatttaacaggtttgttctgaccaaggaaggagaa
cagaagtggtccttgatccaggaatcagagtttataaactctacggggcaattccagggc
ctatttactgtgggccccgtgacccccagtcaaaggtggatattcagatgttacggctat
catgtcaacagcccccaggtgtggtcggaacccagcgatctcttggaaatacatgtgtca
gaagccgatcagcccctcaggccatcaccaaacatatcagacccaaagacagtctcacag
ccccagaattacacaatggagaacctcatcaggatgggggcttcaattttggtccttgtg
cttcttggcgttcttctgttcgaagctcagcacagccaaaggcagacccaacatgcagct
gggagagaaagcagtgcttctttcatggtggcagacacctgggaataa

DBGET integrated database retrieval system