KEGG   Mus musculus (mouse): 100038927
Entry
100038927         CDS       T01002                                 

Gene name
Defa30, Gm15284
Definition
(RefSeq) defensin, alpha, 30
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100038927 (Defa30)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100038927 (Defa30)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100038927 (Defa30)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100038927
NCBI-ProteinID: NP_001170956
MGI: 3808881
Ensembl: ENSMUSG00000074444
Vega: OTTMUSG00000019742
UniProt: E9QPZ2
Position
8 A2; 8
AA seq 93 aa
MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGSSLQEESLR
DLVCYCRARGCKGRERMNGTCSKGHLMYMLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactaatcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccaggggaagaggaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagagcaagaggctgcaaaggaagagaacgcatgaatgggacc
tgcagtaagggtcatttaatgtacatgctctgctgtcgctga

KEGG   Mus musculus (mouse): 100041688
Entry
100041688         CDS       T01002                                 

Gene name
Defa35, Gm10104
Definition
(RefSeq) defensin, alpha, 35
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041688 (Defa35)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041688 (Defa35)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041688 (Defa35)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100041688
NCBI-ProteinID: NP_001170952
MGI: 3711900
Ensembl: ENSMUSG00000061845
Vega: OTTMUSG00000018258
UniProt: E9QLQ1
Position
8 A2; 8
AA seq 93 aa
MKTFVLLSALVLLAFQVQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHDELSK
KLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggccttccaggtccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcttttggaggccaagaagggtctgctcttcatgatgaattgtcaaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaacgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgctgcagctga

KEGG   Mus musculus (mouse): 100041759
Entry
100041759         CDS       T01002                                 

Gene name
Defa41, Gm15293
Definition
(RefSeq) defensin, alpha, 41
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041759 (Defa41)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041759 (Defa41)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041759 (Defa41)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100041759
NCBI-ProteinID: NP_001170957
MGI: 3705230
Ensembl: ENSMUSG00000079116
Vega: OTTMUSG00000019786
UniProt: D3YX02
Position
8; 8 A2
AA seq 93 aa
MKTFVLLSALVLLAFQAQADPIHKTDEETNTEEQPGEEDQAVSISSGGQEGSALHEELSK
KLICYCRIRGCKRRECVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggccttccaggcccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcctctggaggccaagaagggtctgctcttcatgaagaattgtcaaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaatgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgttgcagctga

KEGG   Mus musculus (mouse): 100041787
Entry
100041787         CDS       T01002                                 

Gene name
Defa40, Gm15292
Definition
(RefSeq) defensin, alpha, 40
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041787 (Defa40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041787 (Defa40)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041787 (Defa40)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 100041787
NCBI-ProteinID: NP_001170958
MGI: 3708769
Ensembl: ENSMUSG00000074441
Vega: OTTMUSG00000019784
UniProt: L7N231
Position
8 A2; 8
AA seq 93 aa
MKTLVLLSALFLLAFQVQADPIQKTDEETNTEVQPEEEEQAMSVSFGNPEGSDLQEESLR
DLGCYCRKRGCTRRERINGTCRKGHLMYTLCCL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttttcctgctggccttccaagtccaggctgat
cctatccaaaaaacagatgaagagactaatactgaggtgcagccagaggaagaggagcag
gctatgtctgtctcctttggaaatccagaaggctctgatcttcaagaagaatcgttgaga
gatctgggatgctattgtagaaaaagaggctgcacaagaagagaacgcattaatgggacc
tgcagaaagggtcatttaatgtacacactctgctgcctctga

KEGG   Mus musculus (mouse): 100041811
Entry
100041811         CDS       T01002                                 

Gene name
Defa27, Gm15299
Definition
(RefSeq) defensin, alpha, 27
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041811 (Defa27)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041811 (Defa27)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041811 (Defa27)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100041811
NCBI-ProteinID: NP_001164426
MGI: 3642780
Ensembl: ENSMUSG00000082211
UniProt: F2Z403
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALALLASQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEESLR
DLICYCRTRGCKRRERLNGTCRKGHLMYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgcccttgccctgctggcctcccaagtccaggctgat
cctatccaaaacagagatgaagagagtaaaattgatgagcagccagggaaagaagaccaa
gctgtttctgtctcctttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctgatatgctattgtagaacaagaggctgcaaaagaagagaacgcctgaatgggacc
tgcagaaagggtcatttaatgtacacgctctgctgccgctga

KEGG   Mus musculus (mouse): 100041890
Entry
100041890         CDS       T01002                                 

Gene name
Defa32, Cryptdin-4, Defa20, Defcr20, Gm15308
Definition
(RefSeq) defensin, alpha, 32
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041890 (Defa32)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041890 (Defa32)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041890 (Defa32)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta
Other DBs
NCBI-GeneID: 100041890
NCBI-ProteinID: NP_001170992
MGI: 3709042
Ensembl: ENSMUSG00000094818
Vega: OTTMUSG00000019860
UniProt: Q45VN2
Position
8 A2; 8
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQPGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcagccaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

KEGG   Mus musculus (mouse): 100041895
Entry
100041895         CDS       T01002                                 

Gene name
Defa37, Gm14850
Definition
(RefSeq) defensin, alpha, 37
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041895 (Defa37)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041895 (Defa37)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041895 (Defa37)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100041895
NCBI-ProteinID: NP_001170993
MGI: 3705236
Ensembl: ENSMUSG00000065956
Vega: OTTMUSG00000018259
UniProt: K9J724
Position
8; 8 A2
AA seq 93 aa
MKTFVLLSALVLLAYQVQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEELSK
KLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggcctaccaggtccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcttttggaggccaagaagggtctgctcttcatgaagaattgtctaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaacgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgctgcagctga

KEGG   Mus musculus (mouse): 100041952
Entry
100041952         CDS       T01002                                 

Gene name
Defa34, Gm15315
Definition
(RefSeq) defensin, alpha, 34
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041952 (Defa34)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041952 (Defa34)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041952 (Defa34)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 100041952
NCBI-ProteinID: NP_001170999
MGI: 3709048
Ensembl: ENSMUSG00000063206
Vega: OTTMUSG00000019924
UniProt: D3Z0J0
Position
8 A2; 8
AA seq 93 aa
MKTIVLLSALVLLAFQVQADPIQKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEELSK
KLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacaattgtcctcctctctgcccttgtcctgctggccttccaagtccaggctgat
cctatccaaaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcctttggaggccaagaagggtctgctcttcatgaagaattgtcaaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaacgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgctgcagctga

KEGG   Mus musculus (mouse): 100294660
Entry
100294660         CDS       T01002                                 

Gene name
Defa2, CR, CR2, Defcr, Defcr-, Defcr-2, Defcr2
Definition
(RefSeq) defensin, alpha, 2
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100294660 (Defa2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100294660 (Defa2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100294660 (Defa2)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta
Other DBs
NCBI-GeneID: 100294660
NCBI-ProteinID: NP_001182563
MGI: 94882
Ensembl: ENSMUSG00000096295
Vega: OTTMUSG00000062184
UniProt: Q8C1N9 Q8C1P0
Position
8 A2; 8
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQAGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcaggcaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

KEGG   Mus musculus (mouse): 100503970
Entry
100503970         CDS       T01002                                 

Gene name
CRS4C
Definition
(RefSeq) cDNA sequence AY761185
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100503970 (CRS4C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100503970 (CRS4C)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100503970 (CRS4C)
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 100503970
NCBI-ProteinID: NP_001012658
MGI: 3630303
Ensembl: ENSMUSG00000079120
Vega: OTTMUSG00000018344
UniProt: Q5ERI8
Position
8; 8 A2
AA seq 94 aa
MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPERYVLQVSGLG
KPPQCPKCPVCSKCPQCPQCPQCPGCPRCNCMTK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagacactcgttctcctctctgcccttgtcctgctggccttctatgtccaggctgat
tctacccaagagactgatgaagagactaaaactgatgatcagccaggggaagaggatcag
ggtgtgtctgtctcctttgaagacccagaacgctatgttcttcaagtttcaggcctagga
aagcctccccagtgcccgaagtgcccagtgtgctcaaagtgcccacagtgcccacagtgc
ccacagtgcccggggtgcccgaggtgcaattgcatgacaaaatga

KEGG   Mus musculus (mouse): 100505096
Entry
100505096         CDS       T01002                                 

Gene name
Defa33, Gm21002
Definition
(RefSeq) defensin, alpha, 33
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100505096 (Defa33)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100505096 (Defa33)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100505096 (Defa33)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta
Other DBs
NCBI-GeneID: 100505096
NCBI-ProteinID: NP_001257484
MGI: 5434357
Ensembl: ENSMUSG00000094362
Vega: OTTMUSG00000062185
UniProt: Q8C1N9
Position
8 A2; 8
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQAGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcaggcaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

KEGG   Mus musculus (mouse): 100862126
Entry
100862126         CDS       T01002                                 

Gene name
Defa36, Gm21498
Definition
(RefSeq) defensin, alpha, 36
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100862126 (Defa36)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100862126 (Defa36)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100862126 (Defa36)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 100862126
NCBI-ProteinID: NP_001257542
MGI: 5434853
Ensembl: ENSMUSG00000094662
Vega: OTTMUSG00000061984
UniProt: K9J724
Position
8 A2; 8
AA seq 93 aa
MKTFVLLSALVLLAYQVQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEELSK
KLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggcctaccaggtccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcttttggaggccaagaagggtctgctcttcatgaagaattgtctaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaacgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgctgcagctga

KEGG   Mus musculus (mouse): 13216
Entry
13216             CDS       T01002                                 

Gene name
Defa1, Defcr, Defcr1, cryptd
Definition
(RefSeq) defensin, alpha 1
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13216 (Defa1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13216 (Defa1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13216 (Defa1)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 DUF3316
Other DBs
NCBI-GeneID: 13216
NCBI-ProteinID: NP_034161
MGI: 94880
UniProt: P11477
Position
8 A2; 8
AA seq 93 aa
MKKLVLLFALVLLGFQVQADSIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLR
DLVCYCRSRGCKGRERMNGTCRKGHLLYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagaaactagtcctactctttgcccttgtcctgcttggcttccaggtccaggctgat
tctatccaaaacacagatgaagagactaaaactgaggagcagccaggagaagaggaccag
gccgtatctgtctcctttggagacccagaaggcacttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagatcaagaggctgcaaaggaagagaacgcatgaatggaacc
tgcagaaagggtcatttattgtacacgctctgctgtcgctga

KEGG   Mus musculus (mouse): 13218
Entry
13218             CDS       T01002                                 

Gene name
Defa29, 2010300L12Rik, 2010319H24Rik, CRS1C, CRS1C-2, CRS1C-4, CRS1C-5, Defa-, Defa-rs1, Defcr-, Defcr-rs1
Definition
(RefSeq) defensin, alpha, 29
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13218 (Defa29)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13218 (Defa29)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13218 (Defa29)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 13218
NCBI-ProteinID: NP_031870
MGI: 94881
Ensembl: ENSMUSG00000074437
Vega: OTTMUSG00000019792
UniProt: Q9D815
Position
8 A2; 8 10.35 cM
AA seq 116 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQR
RFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcgttctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagaggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaagatgtagcccaaaga
aggtttccgtggtgccggaagtgccgagtgtgccagaagtgccaagtgtgccagaagtgc
cctgtgtgcccgacatgcccccagtgcccaaagcagccattgtgcgaagaaaggcaaaat
aaaactgcaatcaccacccaagctccaaatacacagcataaaggctgttga

KEGG   Mus musculus (mouse): 13219
Entry
13219             CDS       T01002                                 

Gene name
Defa-rs10, CRS4C, CRS4C-4, Defcr-r, Defcr-rs10
Definition
(RefSeq) defensin, alpha, related sequence 10
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13219 (Defa-rs10)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13219 (Defa-rs10)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13219 (Defa-rs10)
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 13219
NCBI-ProteinID: NP_031871
MGI: 102516
UniProt: Q64263
Position
8
AA seq 91 aa
MKKLVLLSAFVLLAFQVQADSIQNTDEETKTEEQPGEENQAMSVSFGDPEGSALQDAAVG
MARPCPPCPSCPSCPWCPMCPRCPSCKCNPK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagaaacttgttcttctctctgccttcgttctgctggccttccaggtccaggctgat
tctatccaaaacacagatgaagagactaaaactgaggaacagccaggagaagagaaccag
gctatgtctgtttcctttggagacccggaaggttctgctcttcaagatgcagccgtagga
atggctcggccgtgcccaccatgccccagttgcccgtcatgtccatggtgcccaatgtgc
ccgaggtgcccgagctgcaaatgcaatccaaaataa

KEGG   Mus musculus (mouse): 13221
Entry
13221             CDS       T01002                                 

Gene name
Defa-rs12, CRS4C-5, Defcr-r, Defcr-rs12
Definition
(RefSeq) defensin, alpha, related sequence 12
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13221 (Defa-rs12)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13221 (Defa-rs12)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13221 (Defa-rs12)
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 13221
NCBI-ProteinID: NP_031872
MGI: 102514
UniProt: P50716
Position
8; 8 A2
AA seq 92 aa
MKKLVLLSAFVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSISFGDPEGYALQDAAAI
RRARRCPPCPSCLSCPWCPRCLRCPMCKCNPK
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagaaacttgtcctcctctctgcattcgttctgctggccttccaggtccaggctgat
tctatccaaaacacagatgaagagattaaaactgaggaacagccaggagaagagaaccag
gctgtgtctatctcctttggagacccagaaggctatgctcttcaagatgcagcagccata
agaagggctcgccggtgcccaccatgccccagttgcctgtcatgtccatggtgcccaagg
tgcctgagatgcccaatgtgcaaatgcaatccaaaatga

KEGG   Mus musculus (mouse): 13222
Entry
13222             CDS       T01002                                 

Gene name
Defa-rs2, CRS, CRS4C, CRS4C-1, CRS4C1d, CRS4C1e, CRS4C1f, CRS4C1g, CRS4C1h, CRS4C1i, CRS4C1j, Defcr-, Defcr-rs2, Defcr-rs3
Definition
(RefSeq) defensin, alpha, related sequence 2
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13222 (Defa-rs2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13222 (Defa-rs2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13222 (Defa-rs2)
SSDB
Motif
Pfam: Defensin_propep DUF3316
Other DBs
NCBI-GeneID: 13222
NCBI-ProteinID: NP_031873
MGI: 99592
UniProt: P17534
Position
8
AA seq 91 aa
MKKLVLLFALVLLAFQVQADSIQNTDEETKTEEQPGEKDQAVSVSFGDPQGSALQDAALG
WGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagaaacttgtcctcctctttgcccttgtcctgcttgcattccaggtccaggctgat
tctatccaaaacacagatgaagagactaaaactgaggagcagccaggggaaaaggaccag
gctgtgtctgtctcttttggagacccacaaggctctgctcttcaagatgcagccctagga
tggggtcggcggtgcccacaatgccctagatgcccgtcatgcccatcttgcccgagatgc
ccgaggtgcccgaggtgcaaatgcaatccaaaataa

KEGG   Mus musculus (mouse): 13223
Entry
13223             CDS       T01002                                 

Gene name
Defa-rs4, CRS4, CRS4C, CRS4C-1a, CRS4C1a, Defcr-, Defcr-rs4
Definition
(RefSeq) defensin, alpha,, related sequence 4
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13223 (Defa-rs4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13223 (Defa-rs4)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13223 (Defa-rs4)
SSDB
Motif
Pfam: Defensin_propep
Other DBs
NCBI-GeneID: 13223
NCBI-ProteinID: NP_001005418
MGI: 102512
UniProt: Q70LV9
Position
8
AA seq 91 aa
MKKLVLLFALVLLAFQVQADSIQNTDEEIKTEEQPGEENQAVSVSFGDPQGSALQDAAVG
WGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaagaaacttgtcctcctctttgcccttgtcctgcttgcattccaggtccaggctgat
tctatccaaaacacagatgaagagattaaaactgaggaacagccaggagaagagaaccag
gctgtgtctgtctcctttggagacccacaaggctctgctcttcaagatgcagccgtagga
tggggtcggcggtgcccacaatgccctagatgcccgtcatgcccatcttgcccgagatgc
ccgaggtgcccgaggtgcaaatgcaatccaaaataa

KEGG   Mus musculus (mouse): 13226
Entry
13226             CDS       T01002                                 

Gene name
Defa31, CRS4C, CRS4C-2, CRS4C2, CRS4C2b, CRS4C2c, CRS4C2d, CRS4C3a, CRS4C3a2, CRS4C3b, CRS4C3c, CRS4C3d, CRS4C3e, Defa-, Defa-rs7, Defa23, Defcr-, Defcr-rs7, Defcr23
Definition
(RefSeq) defensin, alpha, 31
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13226 (Defa31)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13226 (Defa31)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13226 (Defa31)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13226
NCBI-ProteinID: NP_031874
MGI: 102509
Ensembl: ENSMUSG00000074442
Vega: OTTMUSG00000019762
UniProt: Q5G866
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAFQVQADPIQNTDEETKTEEQPGKEDQAVSVSFGDPEGSSLQEESLR
DLVCYCRTRGCKRRERMNGTCRKGHLIYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcatcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagggaaagaggaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagaacaagaggctgcaaaagaagagaacgcatgaatgggacc
tgcagaaagggtcatttaatatacacgctctgctgtcgctga

KEGG   Mus musculus (mouse): 13236
Entry
13236             CDS       T01002                                 

Gene name
Defa25, Defcr-2, Defcr2, Defcr25
Definition
(RefSeq) defensin, alpha, 25
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13236 (Defa25)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13236 (Defa25)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13236 (Defa25)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13236
NCBI-ProteinID: NP_031875
MGI: 3630385
Ensembl: ENSMUSG00000094687
Vega: OTTMUSG00000019700
UniProt: Q5G864
Position
8 A2; 8
AA seq 92 aa
MKTLVLLSALALLAFQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEECED
LICYCRTRGCKRRERLNGTCRKGHLMYMLWCC
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgcccttgccctgctggccttccaagtccaggctgat
cctatccaaaacagagatgaagagagtaaaattgatgagcagccagggaaagaagaccaa
gctgtttctgtctcctttggagacccagaaggctcttctcttcaagaggaatgtgaagat
ctgatatgctattgtagaacaagaggctgcaaaagaagagaacgcctgaatgggacctgc
agaaagggtcatttaatgtacatgctctggtgctgctga

KEGG   Mus musculus (mouse): 13237
Entry
13237             CDS       T01002                                 

Gene name
Defa3, Defa27, Defcr, Defcr-, Defcr-3, Defcr3
Definition
(RefSeq) defensin, alpha, 3
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13237 (Defa3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13237 (Defa3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13237 (Defa3)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13237
NCBI-ProteinID: NP_031876
MGI: 94883
Ensembl: ENSMUSG00000074440
Vega: OTTMUSG00000019782
UniProt: P28310
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLR
DLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccaggggaagacgaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagaaaaagaggctgcaaaagaagagaacgcatgaatgggacc
tgcagaaagggtcatttaatgtacacactctgctgtcgctga

KEGG   Mus musculus (mouse): 13238
Entry
13238             CDS       T01002                                 

Gene name
Defa4, Cr, Crp4, Defa28, Defcr, Defcr4
Definition
(RefSeq) defensin, alpha, 4
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13238 (Defa4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13238 (Defa4)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13238 (Defa4)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13238
NCBI-ProteinID: NP_034169
MGI: 99584
UniProt: P28311
Structure
PDB: 
2LEY 2LEW 2GWP 2GW9 1TV0

Position
8; 8 A2
AA seq 92 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQPGEEDQAVSISFGGQEGSALHEKSLR
GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcctttggaggccaagaagggtctgctcttcatgaaaaatctttgaga
ggtttgttatgctattgtagaaaaggacactgcaaaagaggagaacgagttcgtgggact
tgtggaatacgatttttgtactgctgcccccgccgctga

KEGG   Mus musculus (mouse): 13239
Entry
13239             CDS       T01002                                 

Gene name
Defa5, Defa29, Defcr, Defcr29, Defcr5
Definition
(RefSeq) defensin, alpha, 5
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13239 (Defa5)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13239 (Defa5)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13239 (Defa5)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 13239
NCBI-ProteinID: NP_031877
MGI: 99583
Ensembl: ENSMUSG00000074439
Vega: OTTMUSG00000019785
UniProt: L7N230
Position
8; 8 A2
AA seq 93 aa
MKTFVLLSALVLLAFQAQADPIHKTDEETNTEEQPGEEDQAVSISFGGQEGSALHEELSK
KLICYCRIRGCKRRERVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggccttccaggcccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcctttggaggccaagaagggtctgctcttcatgaagaattgtcaaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaacgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgctgcagctga

KEGG   Mus musculus (mouse): 13240
Entry
13240             CDS       T01002                                 

Gene name
Defa6, Defcr, Defcr6
Definition
(RefSeq) defensin, alpha, 6
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    13240 (Defa6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13240 (Defa6)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    13240 (Defa6)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 13240
NCBI-ProteinID: NP_031878
MGI: 99582
UniProt: P50704
Position
8; 8 A2
AA seq 93 aa
MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGTSLQEESLR
DLVCYCRARGCKGRERMNGTCRKGHLLYMLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactaatcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaatacagatgaagagactaaaactgaggagcagccaggggaagaggaccag
gctgtgtctgtctcttttggagacccagaaggcacttctcttcaagaggaatcattgaga
gatctggtatgctattgtagagcaagaggctgcaaaggaagagaacgcatgaatgggacc
tgcagaaagggtcatttattgtacatgctctgctgtcgctga

KEGG   Mus musculus (mouse): 23855
Entry
23855             CDS       T01002                                 

Gene name
Defa17, AU014719, Cryp, Cryp17, Defa3, Defcr1, Defcr17, Defcr3
Definition
(RefSeq) defensin, alpha, 17
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    23855 (Defa17)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    23855 (Defa17)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    23855 (Defa17)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 23855
NCBI-ProteinID: NP_001161262
MGI: 1345152
Ensembl: ENSMUSG00000060208
Vega: OTTMUSG00000019892
UniProt: P28310
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETKTEEQPGEDDQAVSVSFGDPEGSSLQEESLR
DLVCYCRKRGCKRRERMNGTCRKGHLMYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccaggggaagacgaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagaaaaagaggctgcaaaagaagagaacgcatgaatgggacc
tgcagaaagggtcatttaatgtacacactctgctgtcgctga

KEGG   Mus musculus (mouse): 382000
Entry
382000            CDS       T01002                                 

Gene name
Defa39, AY76118, CRS1C, CRS1C-3, CRS1C-6
Definition
(RefSeq) defensin, alpha, 39
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    382000 (Defa39)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    382000 (Defa39)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    382000 (Defa39)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 382000
NCBI-ProteinID: NP_001007583
MGI: 3611585
Ensembl: ENSMUSG00000058618
Vega: OTTMUSG00000019927
UniProt: Q9D848
Position
8; 8 A2
AA seq 116 aa
MKTLVLLSALALLAFQVQADPIKNTDEETKTGEQPEEEDQAVSVSFGGTEGSALQYVAQR
RFPWCRKCPVCQKCQVCQKCPVCPTCPQCPKLPLCKERQNKSAITTQAPNTQHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttccaggtccaggctgat
cctatcaaaaacacagatgaagagactaaaactggggagcagccagaggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaatatgtagcccaaaga
aggtttccgtggtgccggaagtgcccagtgtgccagaagtgccaagtgtgccagaagtgc
cctgtgtgcccgacatgcccccagtgcccgaagctgccattgtgcaaagaaaggcaaaat
aaaagtgcaatcaccacccaagctccaaatacacagcataaaggctgttga

KEGG   Mus musculus (mouse): 382059
Entry
382059            CDS       T01002                                 

Gene name
Defa22, Defcr2, Defcr22
Definition
(RefSeq) defensin, alpha, 22
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    382059 (Defa22)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    382059 (Defa22)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    382059 (Defa22)
SSDB
Motif
Pfam: Defensin_propep Defensin_beta Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 382059
NCBI-ProteinID: NP_997541
MGI: 3639039
Ensembl: ENSMUSG00000074443
Vega: OTTMUSG00000019763
UniProt: Q8C1N8 W4VSN6
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEEDQAVSVSFGGQEGSALHEKLSR
DLICLCRKRRCNRGELFYGTCAGPFLRCCRRRR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcatcctgctggcctaccaggtccagactgat
cctatccaaaacacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggaggccaagaaggatctgctcttcatgaaaaattgtcgaga
gatctgatctgcctttgtagaaaacgtcgctgcaatagaggagaactattttatgggacc
tgcgcaggaccttttttgcgctgctgccgccgccgccgctga

KEGG   Mus musculus (mouse): 497114
Entry
497114            CDS       T01002                                 

Gene name
Defa23, Defcr2, Defcr23
Definition
(RefSeq) defensin, alpha, 23
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    497114 (Defa23)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    497114 (Defa23)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    497114 (Defa23)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 497114
NCBI-ProteinID: NP_001012307
MGI: 3630381
Ensembl: ENSMUSG00000074446
Vega: OTTMUSG00000019488
UniProt: Q5G866
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAFQVQADPIQNTDEETKTEEQPGKEDQAVSVSFGDPEGSSLQEESLR
DLVCYCRTRGCKRRERMNGTCRKGHLIYTLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgccctcatcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagggaaagaggaccag
gctgtgtctgtctcttttggagacccagaaggctcttctcttcaagaggaatcgttgaga
gatctggtatgctattgtagaacaagaggctgcaaaagaagagaacgcatgaatgggacc
tgcagaaagggtcatttaatatacacgctctgctgtcgctga

KEGG   Mus musculus (mouse): 503491
Entry
503491            CDS       T01002                                 

Gene name
Defa24, Defcr2, Defcr24
Definition
(RefSeq) defensin, alpha, 24
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    503491 (Defa24)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    503491 (Defa24)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    503491 (Defa24)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 503491
NCBI-ProteinID: NP_001019396
MGI: 3630383
Ensembl: ENSMUSG00000064213
Vega: OTTMUSG00000019980
UniProt: Q5G865
Position
8; 8 A2
AA seq 93 aa
MKTLILLSALVLLAFQVQADPIQNTDEETKTEEQPGEEDQAVSVSFGDPEGASLQEESLR
DLVCYCRARGCKGRERMNGTCSKGHLLYMLCCR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacactaatcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaatacagatgaagagactaaaactgaggagcagccaggggaagaggaccag
gctgtgtctgtctcttttggagacccagaaggcgcttctcttcaagaggaatcattgaga
gatctggtatgctattgtagagcaagaggctgcaaaggaagagaacgcatgaatgggacc
tgcagtaagggtcatttattgtacatgctctgctgtcgctga

KEGG   Mus musculus (mouse): 626682
Entry
626682            CDS       T01002                                 

Gene name
Defa28, EG626682, Gm6696
Definition
(RefSeq) defensin, alpha, 28
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    626682 (Defa28)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    626682 (Defa28)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    626682 (Defa28)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_RK-1
Other DBs
NCBI-GeneID: 626682
NCBI-ProteinID: NP_001170994
MGI: 3646688
Ensembl: ENSMUSG00000074434
Vega: OTTMUSG00000019896
UniProt: D3Z1V9
Position
8; 8 A2
AA seq 94 aa
MKTLVLLSALALLAFQVQADPIQNRDEESKIDEQPGKEDQAVSVSFGDPEGSSLQEECDA
LRDRICYCRTSCKKRERLNGTCRKGHLMYKLCCR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagacactagtcctcctctctgcccttgccctgctggccttccaagtccaggctgat
cctatccaaaacagagatgaagagagtaaaattgatgagcagccagggaaagaagaccaa
gctgtttctgtctcctttggagacccagaaggctcttctcttcaagaggaatgtgacgcg
ttgagagatcggatatgctattgtagaacaagctgcaaaaaaagagaacgcctgaatggg
acctgcagaaagggtcatttaatgtacaagctctgctgccgctga

KEGG   Mus musculus (mouse): 626708
Entry
626708            CDS       T01002                                 

Gene name
Defa26, Defcr2, Defcr26
Definition
(RefSeq) defensin, alpha, 26
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    626708 (Defa26)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    626708 (Defa26)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    626708 (Defa26)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 626708
NCBI-ProteinID: NP_001073402
MGI: 3630390
Ensembl: ENSMUSG00000060070
Vega: OTTMUSG00000019889
UniProt: Q3L180
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALFLLAFQVQADPIQNTDEETNTEVQPQEEDQAVSVSFGNPEGSDLQEESLR
DLGCYCRKRGCTRRERINGTCRKGHLMYTLCCL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttttcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaatactgaggtgcagccacaggaagaggaccag
gctgtgtctgtctcctttggaaatccagaaggctctgatcttcaagaagaatcgttgaga
gatctgggatgctattgtagaaaaagaggctgtacaagaagagaacgcattaatgggacc
tgcagaaagggtcatttaatgtacacactctgctgcctctga

KEGG   Mus musculus (mouse): 634825
Entry
634825            CDS       T01002                                 

Gene name
Defa38, CRS1C-2, Gm14851
Definition
(RefSeq) defensin, alpha, 38
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    634825 (Defa38)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    634825 (Defa38)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    634825 (Defa38)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 634825
NCBI-ProteinID: NP_001170953
MGI: 3709605
Ensembl: ENSMUSG00000061958
Vega: OTTMUSG00000018260
UniProt: Q5ERJ0
Position
8 A2; 8
AA seq 116 aa
MKTLVLLSALALLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQR
RFLWCRKCPVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactgaggagcagccagaggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaagatgtagcccaacga
aggtttctgtggtgccggaagtgcccagtgtgccagaagtgccaagtgtgccagaagtgc
cctgtgtgccccacatgccctcagtgcccaaagcagccattgtgcgaagaaaggcaaaat
aaaactgcaatcaccacccaagctccaaatacacagcataaaggctgttga

KEGG   Mus musculus (mouse): 66298
Entry
66298             CDS       T01002                                 

Gene name
Defa21, 2010016B13Rik, Defcr2, Defcr21
Definition
(RefSeq) defensin, alpha, 21
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    66298 (Defa21)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    66298 (Defa21)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    66298 (Defa21)
SSDB
Motif
Pfam: Defensin_propep Defensin_beta Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 66298
NCBI-ProteinID: NP_899076
MGI: 1913548
Ensembl: ENSMUSG00000074447
Vega: OTTMUSG00000019489
UniProt: Q8C1P2
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEDDQAVSVSFGGQEGSALHEKLSR
DLICLCRNRRCNRGELFYGTCAGPFLRCCRRRR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcatcctgctggcctaccaggtccagactgat
cctatccaaaacacagatgaagagactaatactgaggagcagccaggggaagatgaccag
gctgtgtctgtctcctttggaggccaagaaggatctgctcttcatgaaaaattgtcgaga
gatctgatctgcctttgtagaaatcgtcgctgcaatagaggagaactattttatgggacc
tgcgcaggaccttttttgcgctgctgccgccgccgccgctga

KEGG   Mus musculus (mouse): 665927
Entry
665927            CDS       T01002                                 

Gene name
Defa42, EG665927, Gm7849
Definition
(RefSeq) defensin, alpha, 42
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    665927 (Defa42)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    665927 (Defa42)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    665927 (Defa42)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 665927
NCBI-ProteinID: NP_001170989
MGI: 3645033
Ensembl: ENSMUSG00000079114
Vega: OTTMUSG00000019859
UniProt: D3YX03
Position
8; 8 A2
AA seq 116 aa
MKTLVLLSALALLALQVQADPIQNTDEETKTQEQPGEEDQAVSVSFGGTEGSALQDVAQR
RFPWCRKCRVCQKCEVCQKCPVCPTCPQCPKQPLCKERQNKTAITTQAPNTHHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttacaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactcaggagcagccaggggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaagatgtagcccaaaga
agatttccgtggtgccggaagtgccgagtgtgccagaagtgcgaagtgtgccagaagtgc
cctgtgtgcccgacatgcccccagtgcccaaagcagccattgtgcaaagaaaggcaaaat
aaaactgctatcaccacccaagctccaaatacacatcataaaggctgttga

KEGG   Mus musculus (mouse): 665956
Entry
665956            CDS       T01002                                 

Gene name
Defa43, EG665956, Gm7861
Definition
(RefSeq) defensin, alpha, 43
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    665956 (Defa43)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    665956 (Defa43)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    665956 (Defa43)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 665956
NCBI-ProteinID: NP_001170997
MGI: 3648003
Ensembl: ENSMUSG00000079113
Vega: OTTMUSG00000019893
UniProt: D3YX03
Position
8; 8 A2
AA seq 116 aa
MKTLVLLSALALLALQVQADPIQNTDEETKTQEQPGEEDQAVSVSFGGTEGSALQDVAQR
RFPWCRKCRVCQKCEVCQKCPVCPTCPQCPKQPLCKERQNKTAITTQAPNTHHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttacaggtccaggctgat
cctatccaaaacacagatgaagagactaaaactcaggagcagccaggggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaagatgtagcccaaaga
agatttccgtggtgccggaagtgccgagtgtgccagaagtgcgaagtgtgccagaagtgc
cctgtgtgcccgacatgcccccagtgcccaaagcagccattgtgcaaagaaaggcaaaat
aaaactgctatcaccacccaagctccaaatacacatcataaaggctgttga

KEGG   Mus musculus (mouse): 68009
Entry
68009             CDS       T01002                                 

Gene name
Defa20, 2010016F14Rik, Defcr2, Defcr20
Definition
(RefSeq) defensin, alpha, 20
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    68009 (Defa20)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    68009 (Defa20)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    68009 (Defa20)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N Defensin_beta
Other DBs
NCBI-GeneID: 68009
NCBI-ProteinID: NP_899091
MGI: 1915259
Ensembl: ENSMUSG00000095066
Vega: OTTMUSG00000019856
UniProt: Q45VN2
Position
8; 8 A2
AA seq 95 aa
MKTLVLLSALVLLAFQVQADPIQNTDEETNTEEQPGEEDQAVSVSFGDPEGSALHEKSSR
DLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcgtcctgctggccttccaggtccaggctgat
cctatccaaaacacagatgaggagactaatactgaggagcagccaggggaggaggaccag
gctgtgtctgtctcctttggagacccagaaggatctgctcttcatgaaaaatcgtcgaga
gatctgatatgctattgtagaaaaggaggctgcaatagaggagaacaagtttatgggacc
tgctcaggacgacttttgttctgctgccgccgccgccaccgccactga

DBGET integrated database retrieval system