KEGG   Mus musculus (mouse): 100038947
Entry
100038947         CDS       T01002                                 

Gene name
Sirpb1c
Definition
(RefSeq) signal-regulatory protein beta 1C
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100038947 (Sirpb1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    100038947 (Sirpb1c)
   04090 CD molecules [BR:mmu04090]
    100038947 (Sirpb1c)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   100038947 (Sirpb1c)
CD molecules [BR:mmu04090]
 Proteins
  100038947 (Sirpb1c)
SSDB
Motif
Pfam: C1-set Ig_3 V-set C2-set_2 ig Ig_2 I-set
Other DBs
NCBI-GeneID: 100038947
NCBI-ProteinID: NP_001166930
MGI: 3807521
Ensembl: ENSMUSG00000074677
Vega: OTTMUSG00000021248
UniProt: Q1AN90
Position
3; 3 A1
AA seq 391 aa
MLLLDAWTHIPHCVLLLILLLGLKGAAMRELKVIQPVKSFFVGAGGSATLNCTVTSLLPV
GPIRWFKGVGQSRLLIYSFTGERFPRITNVSDVTKRSNLDFSIRISNVTPADSGTYYCVK
FQRGPSEPDMEIQSGGGTELSVFAKPSSPMVSGPAARAVPQQTVAFTCRSHGFFPRNLTL
KWFKNGNEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRG
IAHISEFIQVPPTLEISQQPTMVWNVIIVTCQIQKFYPPRFQVTWLENGNISRREVPFTL
IVNKDGTYNWISCLLVNISALEENMVVTCQVEHDGQAEVIETHTVVVTEHQRVKELKTAG
IAKIPVAVLLGSKILLLIAATVIYMRKKQNA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcttctcctagatgcctggacccacattcctcactgtgtcctgctgttgatcctgctt
ctgggacttaaaggagcagctatgagagagctgaaggtgatccaacctgttaaatcattt
tttgttggtgctggagggtcagccactctgaactgcacagtgacatccctcctccctgtg
gggcccataaggtggttcaagggtgtaggacaaagtcgactcttgatatactcgttcaca
ggagaacgcttcccccgaataacaaatgtttcagatgttacaaagagaagcaacctggac
ttttccatccgtatcagtaatgtcactcctgctgattcgggtacctactactgtgtgaag
ttccagagaggaccatcagagcctgacatggagattcagtctggaggtggcactgagttg
tcagtatttgctaaaccatcttcacctatggtctccggtcctgcagccagagctgtccct
cagcagacagtggcctttacatgcagatcccatggattctttccgcggaacctcacgctg
aagtggttcaagaatggaaatgagatctctcacttggaaacttctgtggaacccgaagaa
acaagtgtctcctatagagtttccagcacagtccaggtggtgttggaacctagggatgtc
cgctctcagatcatctgtgaagtggatcatgtcactttagatcgagcccctctcagaggg
attgctcacatctctgagttcattcaagttccacccaccctggagatcagccagcagcca
acaatggtatggaatgtgataattgtcacctgccaaatacagaagttctatcctccaagg
tttcaggtgacctggttagagaatggaaatatatcccggagagaagtaccttttacactt
atagtaaacaaggatggaacttacaactggatcagctgtctcttggtgaacatatctgcc
cttgaggagaacatggtagtgacatgccaggttgagcatgatggacaagcagaagtcatt
gaaacccatactgtggtggtcactgaacatcagagagtgaaagaactgaagacggcaggt
attgctaaaatacctgtagctgtgctccttggatccaaaatactgctgttaattgctgcc
actgtcatttacatgcgtaagaagcaaaatgcctga

KEGG   Mus musculus (mouse): 19261
Entry
19261             CDS       T01002                                 

Gene name
Sirpa, AI835480, Bi, Bit, CD172, CD172a, P8, P84, Pt, Ptpns1, SHP, SHP-1, SHPS-1, SIRP
Definition
(RefSeq) signal-regulatory protein alpha
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19261 (Sirpa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    19261 (Sirpa)
   04090 CD molecules [BR:mmu04090]
    19261 (Sirpa)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   19261 (Sirpa)
CD molecules [BR:mmu04090]
 Proteins
  19261 (Sirpa)
SSDB
Motif
Pfam: C1-set Ig_3 V-set C2-set_2 ig Ig_2 I-set SIT Rax2 DUF6479
Other DBs
NCBI-GeneID: 19261
NCBI-ProteinID: NP_001277948
MGI: 108563
Ensembl: ENSMUSG00000037902
Vega: OTTMUSG00000015506
UniProt: P97797
Position
2 F1; 2 63.19 cM
AA seq 513 aa
MEPAGPAPGRLGPLLLCLLLSASCFCTGATGKELKVTQPEKSVSVAAGDSTVLNCTLTSL
LPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYY
CVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRN
ITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSP
LRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTP
KNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSM
QTFPDNNATHNWNVFIGVGVACALLVVLLMAALYLLRIKQKKAKGSTSSTRLHEPEKNAR
EITQVQSLIQDTNDINDITYADLNLPKEKKPAPRAPEPNNHTEYASIETGKVPRPEDTLT
YADLDMVHLSRAQPAPKPEPSFSEYASVQVQRK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggagcccgccggcccggcccctggccgcctagggccgctgctgctctgcctgctgctc
tccgcgtcctgtttctgtacaggagccacggggaaggaactgaaggtgactcagcctgag
aaatcagtgtctgttgctgctggggattcgaccgttctgaactgcactttgacctccttg
ttgccggtgggacccattaggtggtacagaggagtagggccaagccggctgttgatctac
agtttcgcaggagaatacgttcctcgaattagaaatgtttcagatactactaagagaaac
aatatggacttttccatccgtatcagtaatgtcaccccagcagatgctggcatctactac
tgtgtgaagttccagaaaggatcatcagagcctgacacagaaatacaatctggaggggga
acagaggtctatgtactcgccaaaccttctccaccggaggtatccggcccagcagacagg
ggcatacctgaccagaaagtgaacttcacctgcaagtctcatggcttctctccccggaat
atcaccctgaagtggttcaaagatgggcaagaactccaccccttggagaccaccgtgaac
cctagtggaaagaatgtctcctacaacatctccagcacagtcagggtggtactaaactcc
atggatgttaattctaaggtcatctgcgaggtagcccacatcaccttggatagaagccct
cttcgtgggattgctaacctgtctaacttcatccgagtttcacccaccgtgaaggtcacc
caacagtccccgacgtcaatgaaccaggtgaacctcacctgccgggctgagaggttctac
cccgaggatctccagctgatctggctggagaatggaaacgtatcacggaatgacacgccc
aagaatctcacaaagaacacggatgggacctataattacacaagcttgttcctggtgaac
tcatctgctcatagagaggacgtggtgttcacgtgccaggtgaagcacgaccaacagcca
gcgatcacccgaaaccataccgtgctgggatttgcccactcgagtgatcaagggagcatg
caaaccttccctgataataatgctacccacaactggaatgtcttcatcggtgtgggcgtg
gcgtgtgctttgctcgtagtcctgctgatggctgctctctacctcctccggatcaaacag
aagaaagccaaggggtcaacatcttccacacggttgcacgagcccgagaagaacgccagg
gaaataacccaggtacagtctttgatccaggacacaaatgacatcaacgacatcacatac
gcagacctgaatctgcccaaagagaagaagcccgcaccccgggcccctgagcctaacaac
cacacagaatatgcaagcattgagacaggcaaagtgcctaggccagaggataccctcacc
tatgctgacctggacatggtccacctcagccgggcacagccagcccccaagcctgagcca
tctttctcagagtatgctagtgtccaggtccagaggaagtga

KEGG   Mus musculus (mouse): 320832
Entry
320832            CDS       T01002                                 

Gene name
Sirpb1a, 9930027N05Rik, SIRP-beta, Sirpb, Sirpb1
Definition
(RefSeq) signal-regulatory protein beta 1A
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    320832 (Sirpb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    320832 (Sirpb1a)
   04090 CD molecules [BR:mmu04090]
    320832 (Sirpb1a)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   320832 (Sirpb1a)
CD molecules [BR:mmu04090]
 Proteins
  320832 (Sirpb1a)
SSDB
Motif
Pfam: C1-set Ig_3 V-set C2-set_2 ig Ig_2 I-set
Other DBs
NCBI-GeneID: 320832
NCBI-ProteinID: NP_001002898
MGI: 2444824
Ensembl: ENSMUSG00000095788
Vega: OTTMUSG00000052297
UniProt: Q6F5F2
Position
3; 3 A1
AA seq 391 aa
MLLLDAWTHIPHSVLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTSLLPV
GPIRWYRGVGQSRLLIYPFTGEHSPRITNVSDVTKRNNMDFSIRISNVTPADSGTYYCVK
FQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTL
KWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRG
IAHISEFIQVPPTLEIRQQPTMVWNVINVTCQIQKFYPPSFQLTWLENGNISRREVPFTL
IVNKDGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEHQRVKELKTAG
IAKIPVAVLLGSKILLLIAATVIYMHKKQNA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcttctcctagatgcctggacccacattcctcacagtgtcctgctgttgatcctgctt
ctgggatttaaaggagcagctgtgagagagctgaaagtgatccaacctgttaaatcattt
tttgttggtgctggagggtcagccactctaaactgcacagtgacatccctcctccctgtg
gggcccataaggtggtataggggtgtaggacaaagtcgactcttgatatacccgttcaca
ggagaacattccccccgaataacaaatgtttcagatgttacaaagagaaacaacatggac
ttttccatccgtatcagtaatgtcactcctgctgattcgggtacctactactgtgtgaag
ttccagagaggatcatcagagcctgacattgagattcagtctggaggtggcactgagttg
ttagtccttgctaaaccatcttcacctatggtctccggtcctgcagccagagctgtccct
cagcagacagtgacctttacatgcagatcccatggattctttccgcggaacctcacgctg
aagtggttcaagaatggagatgagatctctcacttggaaacttctgtggaaccggaagaa
acaagtgtctcctatagagtttccagcacagtccaggtggtgttggaacctagggatgtc
cgctctcagatcatctgtgaagtggatcatgtcactttagatcgagcccctctcagaggg
attgctcacatctctgagttcattcaagttccacccaccctggagatccgccagcagcca
acaatggtttggaatgtgataaatgtcacctgccaaatacagaagttctatcctccaagt
tttcagttgacctggttagagaatggaaatatatcccggagagaagtaccttttacactt
atagtaaacaaggatggaacttacaactggatcagctgtctcttggtgaacatatctgcc
cttgaggagaacatggtagtgacatgcaaggttgagcatgatgaacaagcagaagtcatt
gaaacccatactgtgctggtcactgaacatcagagagtgaaagaactgaagacggcaggt
attgctaaaatacctgtagctgtgctccttggatccaaaatactgctgttaattgctgcc
actgtcatttacatgcataagaagcaaaatgcctga

KEGG   Mus musculus (mouse): 668101
Entry
668101            CDS       T01002                                 

Gene name
Sirpb1b
Definition
(RefSeq) signal-regulatory protein beta 1B
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    668101 (Sirpb1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    668101 (Sirpb1b)
   04090 CD molecules [BR:mmu04090]
    668101 (Sirpb1b)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   668101 (Sirpb1b)
CD molecules [BR:mmu04090]
 Proteins
  668101 (Sirpb1b)
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 V-set ig Ig_2 I-set
Other DBs
NCBI-GeneID: 668101
NCBI-ProteinID: NP_001166931
MGI: 3779828
Ensembl: ENSMUSG00000095028
Vega: OTTMUSG00000052298
UniProt: Q3U390
Position
3 A1; 3
AA seq 391 aa
MLLLDAWTHIPHSVLLLILLLGLKGAAMRELKVIQPVKSFFVGAGGSATLNCTVTSLLPV
GPIRWYRGVGQSRLLIQSFTGEHFPRITSVSDVTKRNNLDFSIRISNVTPADSGTYYCVK
FQRGSSESDREIQSGGGTELSVLAKPSSPMVSGPAARAVPKQTVTFTCRSHGFFPRNLTL
KWFKNGNEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRG
IAHISEFIQVPPTLEISQQPTMVWNVIIVTCQIQKFYPPRFQVTWLENGNISRREVPFTL
IVNKDGTYNWISCLLVNISALEENMVVTCQVEHDGQAEVIETHTVVVTEHQRVKELKTAG
IAKIPVAVLLGSKILLLIAATVIYMHKKQNA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcttctcctagatgcctggacccacattcctcatagtgtcctgctgttgatcctgctt
ctgggacttaaaggagcagctatgagagagctgaaggtgatccaacctgttaaatcattt
tttgttggtgctggagggtcagccactctgaactgcacagtgacatccctcctccctgtg
gggcccataaggtggtacaggggtgtaggacaaagtcgactcttgatacagtcgttcaca
ggagaacatttcccccgaataacaagtgtttcagatgttacaaagagaaacaacctggac
ttttccatccgtatcagtaatgtcactcctgctgattcgggtacctattactgtgtgaag
ttccagagaggatcatcagagtctgacagagagattcagtctggaggtggcactgagttg
tcagtacttgctaaaccatcttcacctatggtctccggtcctgcagccagagctgtccct
aagcagacagtgacctttacatgcagatcccatggattctttccgcggaacctcacgctg
aagtggttcaagaatggaaatgagatctctcacttggaaacttctgtggaacccgaagaa
acaagtgtctcctatagagtttccagcacagtccaggtggtgttggaacctagggatgtc
cgctctcagatcatttgtgaagtggatcatgtcactttagatcgagcccctctcagaggg
attgctcacatctctgagttcattcaagttccacccaccctggagatcagccagcagcca
acaatggtatggaatgtgataattgtcacctgccaaatacagaagttctatcctccaagg
tttcaggtgacctggttagagaatggaaatatatcccggagagaagtaccttttacactt
atagtaaacaaggatggaacttacaactggatcagctgtctcttggtgaacatatctgcc
cttgaggagaacatggtagtgacatgccaggttgagcatgatggacaagcagaagtcatt
gaaacccatactgtggtggtcactgaacatcagagagtgaaagaactgaagacggcaggt
attgctaaaatacctgtagctgtgctccttggatccaaaatactgctgttaattgctgcc
actgtcatttacatgcataagaagcaaaatgcctga

KEGG   Mus musculus (mouse): 751864
Entry
751864            CDS       T01002                                 

Gene name
Gm9733
Definition
(RefSeq) predicted gene 9733
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    751864 (Gm9733)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    751864 (Gm9733)
   04090 CD molecules [BR:mmu04090]
    751864 (Gm9733)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   751864 (Gm9733)
CD molecules [BR:mmu04090]
 Proteins
  751864 (Gm9733)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2
Other DBs
NCBI-GeneID: 751864
NCBI-ProteinID: NP_001070147
MGI: 3780136
Ensembl: ENSMUSG00000078783
Vega: OTTMUSG00000052296
UniProt: Q1AN91
Position
3 A1; 3
AA seq 178 aa
MHHLDFRPHTLHRTLLMTLLLGLTGTAAKELKVIQPEKSVSVITGESTILNCTVTSLLPV
GPIKWIRKMGQCRQLIYSFTGEHFPRVRNVSDATKRSNLDFSIHISNVTLADYGTYYCVK
FLRTYSEEEEFQYGGGTQLYVCEQKTTDTAKIIVASLLGPKLLLVIVSVMYRHKKQKA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcatcacctggacttccggccacatactctccacagaaccctgctcatgactctactc
ctgggacttacaggaacagctgcaaaagagctgaaggtgattcagcctgagaaatcagtt
tctgtcatcactggagagtcgaccattttaaactgcactgtgacctccctgcttcctgtg
gggcccataaagtggatcagaaaaatgggacaatgtcggcagttaatatatagtttcaca
ggagagcacttccccagagttagaaatgtttcagatgctacaaaaagaagcaacctggac
ttttccatccacatcagtaatgttacacttgctgactacggtacttactactgtgtgaag
ttcttgagaacatactctgaagaggaggagtttcagtatgggggaggcactcagttgtat
gtctgtgaacagaagacaacagatactgctaaaatcatagtagcttcactccttggaccc
aaacttcttctggttattgtctctgtcatgtacaggcacaagaagcagaaggcctga

KEGG   Mus musculus (mouse): 83433
Entry
83433             CDS       T01002                                 

Gene name
Trem2, TREM-2, Trem, Trem2a, Trem2b, Trem2c
Definition
(RefSeq) triggering receptor expressed on myeloid cells 2
  KO
K14378  triggering receptor expressed on myeloid cells 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    83433 (Trem2)
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 83433
NCBI-ProteinID: NP_112544
MGI: 1913150
Ensembl: ENSMUSG00000023992
Vega: OTTMUSG00000021045
UniProt: Q99NH8
Position
17; 17 C
AA seq 227 aa
MGPLHQFLLLLITALSQALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPC
QRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEV
LQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTSILLLLACVL
LSKFLAASILWAVARGRQKPGTPVVRGLDCGQDAGHQLQILTGPGGT
NT seq 684 nt   +upstreamnt  +downstreamnt
atgggacctctccaccagtttctcctgctgctgatcacagccctgtcccaagccctcaac
accacggtgctgcagggcatggccggccagtccttgagggtgtcatgtacttatgacgcc
ttgaagcactgggggagacgcaaggcctggtgtcggcagctgggtgaggagggcccatgc
cagcgtgtggtgagcacacacggtgtgtggctgctggccttcctgaagaagcggaatggg
agcacagtcatcgcagatgacacccttgctggaaccgtcaccatcactctgaagaacctc
caagccggtgacgcgggcctctaccagtgtcagagtctccgaggccgagaggctgaggtc
ctgcagaaagtactggtggaggtgctggaggaccctctagatgaccaagatgctggagat
ctctgggtccccgaggagtcatcgagtttcgagggtgcccaagtggaacacagcacctcc
aggaatcaagagacctccttcccacccacctccattcttctcctcctggcctgcgttctc
ctgagcaagtttcttgcagccagcatcctctgggctgtggccaggggcaggcagaagccg
ggaacacctgtggtcagagggctggactgtggccaagatgctgggcaccaacttcagatc
ctcactggacccggaggtacgtga

DBGET integrated database retrieval system