KEGG   Mus musculus (mouse): 100039053Help
Entry
100039053         CDS       T01002                                 

Gene name
Gm2023
Definition
(RefSeq) predicted gene 2023
  KO
K05512  C-C motif chemokine 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100039053 (Gm2023)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100039053 (Gm2023)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100039053 (Gm2023)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    100039053 (Gm2023)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   100039053 (Gm2023)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100039053
NCBI-ProteinID: XP_001472218
MGI: 3780192
Ensembl: ENSMUSG00000094661
UniProt: O70460 Q548P0
Position
4 A5; 4
AA seq 108 aa AA seqDB search
MAPRVTPLLAFSLLVLWTFPAPTLGGANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCR
VPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgtgtgaccccactcctggccttcagcctgctggttctctggaccttccca
gccccaactctggggggtgctaatgatgcggaagactgctgcctgtctgtgacccagcgc
cccatccctgggaacatcgtgaaagccttccgctaccttcttaatgaagatggctgcagg
gtgcctgctgttgtgttcaccacactaaggggctatcagctctgtgcacctccagaccag
ccctgggtggatcgcatcatccgaagactgaagaagtcttctgccaagaacaaaggcaac
agcaccagaaggagccctgtgtcttga

DBGET integrated database retrieval system