KEGG   Mus musculus (mouse): 100039123Help
Entry
100039123         CDS       T01002                                 

Gene name
Gm14295
Definition
(RefSeq) predicted gene 14295
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: KRAB
Motif
Other DBs
NCBI-GeneID: 100039123
NCBI-ProteinID: NP_001191986
MGI: 3709624
Ensembl: ENSMUSG00000078877
Vega: OTTMUSG00000016219
UniProt: A2BG90
Position
2 H4; 2
AA seq 64 aa AA seqDB search
MDLVTYDDVQVNFTQDEWALLDPSQKSLYKGVMLETYRNLTAIGYIWEEHTIEDHFQTSR
SHGR
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtcacctatgatgacgtgcaggtgaacttcactcaggatgagtgggctttg
ctggatccttctcagaagagtctctacaagggtgtgatgctagagacctacaggaatctc
acagctataggttacatttgggaagaacatacgattgaagaccattttcaaacttctcga
agtcatggaaggtaa

DBGET integrated database retrieval system