KEGG   Mus musculus (mouse): 100039801Help
Entry
100039801         CDS       T01002                                 

Gene name
Cldn24, Gm10107
Definition
(RefSeq) claudin 24
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100039801 (Cldn24)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100039801 (Cldn24)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100039801 (Cldn24)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100039801 (Cldn24)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100039801 (Cldn24)
  Exosomal proteins of colorectal cancer cells
   100039801 (Cldn24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Motif
Other DBs
NCBI-GeneID: 100039801
NCBI-ProteinID: NP_001104788
MGI: 3712484
Ensembl: ENSMUSG00000061974
Vega: OTTMUSG00000061829
UniProt: D3YXJ9
Position
8; 8 B1.1
AA seq 220 aa AA seqDB search
MAFIFRTAMQSVGLSLSLLGWVLAIITTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEV
GRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLT
LGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGG
CVLHCAACSSPAPAASSHYAGAGPRDHGSYLENGTVQPKV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctttcatcttcagaacggccatgcaatcagtagggctttctctgtcattgctggga
tgggttctagccattattaccacatatctaccacactggaagaaccttaacttggagctg
aacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtc
gggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctcc
agggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgt
ggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcacc
ctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtg
gcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgg
gagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggaggg
tgtgtgcttcactgtgcagcctgctcgagcccagctcctgcagcctcgagtcactatgca
ggggcgggacctcgagatcatggttcatacctagaaaatggaactgtacagcctaaagtg
taa

DBGET integrated database retrieval system