KEGG   Mus musculus (mouse): 100039801
Entry
100039801         CDS       T01002                                 

Gene name
Cldn24, Gm10107
Definition
(RefSeq) claudin 24
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100039801 (Cldn24)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100039801 (Cldn24)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100039801 (Cldn24)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100039801 (Cldn24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    100039801 (Cldn24)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100039801 (Cldn24)
  Exosomal proteins of colorectal cancer cells
   100039801 (Cldn24)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 100039801
NCBI-ProteinID: NP_001104788
MGI: 3712484
Ensembl: ENSMUSG00000061974
Vega: OTTMUSG00000061829
UniProt: D3YXJ9
Position
8; 8 B1.1
AA seq 220 aa
MAFIFRTAMQSVGLSLSLLGWVLAIITTYLPHWKNLNLELNEMENWTMGLWKSCVIQEEV
GRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLT
LGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGG
CVLHCAACSSPAPAASSHYAGAGPRDHGSYLENGTVQPKV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctttcatcttcagaacggccatgcaatcagtagggctttctctgtcattgctggga
tgggttctagccattattaccacatatctaccacactggaagaaccttaacttggagctg
aacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtc
gggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctcc
agggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgt
ggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcacc
ctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtg
gcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgg
gagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggaggg
tgtgtgcttcactgtgcagcctgctcgagcccagctcctgcagcctcgagtcactatgca
ggggcgggacctcgagatcatggttcatacctagaaaatggaactgtacagcctaaagtg
taa

KEGG   Mus musculus (mouse): 100042785
Entry
100042785         CDS       T01002                                 

Gene name
Cldn25, Cldn, Cldn2, Cldn21, Cldn21-ps, Cldn25-ps, Gm16492, Gm513
Definition
(RefSeq) claudin 25
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100042785 (Cldn25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100042785 (Cldn25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100042785 (Cldn25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100042785 (Cldn25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    100042785 (Cldn25)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100042785 (Cldn25)
  Exosomal proteins of colorectal cancer cells
   100042785 (Cldn25)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100042785
NCBI-ProteinID: NP_001371194
MGI: 3642767
Ensembl: ENSMUSG00000105298
Position
9; 9 A5.3
AA seq 230 aa
MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEA
GTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCL
LGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGG
LLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctgtagcttccgtgggagagtccagcttggaggtctgctcctctctgtccttggc
tgggtgtgctcctgtgtcaccaccgttcttccccagtggaagactctcactctggatctg
aatgaaatggaaacctgggtctcgggactctgggaggcatgcgtgaatcaggaggaagct
ggcactgtatgcaaagccttcgagtcgtttttgtctctgccccaagagctacaggtagcc
cgaattctcatggtggcttcccatgggctgggactattgggacttctgctgtctagctgc
gggttggaatgcttccggtttcacaggcctggaggagttttcaagactcggctgtgcctc
ctgggagggactctggaagcatcagcttcagctactaccctctttccagtctcctgggtg
gcctatgccacatttcaagacttctgggatgacagcatccctgagattgtgccccggtgg
gagtttggagacgccttgttcctgggctgggctgctgggcttttcctagctgtgggtgga
ctcctcctcatcttttcagcttgcctggaaaatgaagatggatcttcttcctggatggct
gatgccacggccccacaagcctgtgctccagtagaggaagaatttgatggttccttccat
ctcacaccaagaccggtgaaccaggtcatctag

KEGG   Mus musculus (mouse): 114141
Entry
114141            CDS       T01002                                 

Gene name
Cldn16, PC, PCLN1, claudi, claudin-16
Definition
(RefSeq) claudin 16
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    114141 (Cldn16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114141 (Cldn16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    114141 (Cldn16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    114141 (Cldn16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    114141 (Cldn16)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   114141 (Cldn16)
  Exosomal proteins of colorectal cancer cells
   114141 (Cldn16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DUF1118 DuoxA
Other DBs
NCBI-GeneID: 114141
NCBI-ProteinID: NP_444471
MGI: 2148742
Ensembl: ENSMUSG00000038148
Vega: OTTMUSG00000028402
UniProt: Q925N4 Q14BW2
Position
16; 16 B2
AA seq 235 aa
MKDLLQYAACFLAIFSTGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT
CDEYDSIYAEHPLKLVVTRALMITADILAGFGFITLLLGLDCVKFLPDDPQIKVRLCFVA
GTTLLIAGTPGIIGSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAG
ALLTCCLYLFKDVGPERNYPYAMRKPYSTAGVSMAKSYKAPRTETAKMYAVDTRV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaaggatcttcttcagtacgctgcctgcttcttggccatattctccactgggtttttg
atcgtggccacctggacagactgttggatggtgaacgctgatgactccctggaggtgagc
actaaatgcagaggcctgtggtgggagtgtgtaacaaacgcttttgatgggattcgaacc
tgcgatgagtacgactccatatatgcagaacatcccttgaagctggtggtaactcgagca
ctgatgatcacagctgacattttagctggctttggattcatcaccctgctccttggtctg
gactgtgtgaagttcctacctgatgacccacaaattaaagtccgcctttgctttgttgca
gggaccacattactcattgcaggtaccccaggaatcatcggttctgtgtggtatgctgtg
gatgtttacgtcgaacgctcctctctcgttttacacaatatatttcttgggatccaatat
aaatttggttggtcctgctggcttggaatggctgggtctttgggttgctttttggcagga
gctctcctcacctgctgtttgtacctcttcaaagatgttgggcctgagaggaactaccct
tatgccatgaggaagccctattcaactgcaggtgtgtccatggccaagtcctacaaggcc
cctcggacagagacagccaaaatgtatgctgtagacaccagagtataa

KEGG   Mus musculus (mouse): 12737
Entry
12737             CDS       T01002                                 

Gene name
Cldn1, AI596271
Definition
(RefSeq) claudin 1
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12737 (Cldn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12737 (Cldn1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12737 (Cldn1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12737 (Cldn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12737 (Cldn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12737 (Cldn1)
  Exosomal proteins of colorectal cancer cells
   12737 (Cldn1)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 CD20 Voltage_CLC Amastin DUF4134
Other DBs
NCBI-GeneID: 12737
NCBI-ProteinID: NP_057883
MGI: 1276109
Ensembl: ENSMUSG00000022512
Vega: OTTMUSG00000022624
UniProt: O88551 Q4FJV3
Position
16; 16 B2
AA seq 211 aa
MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV
IGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGV
LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaacgcggggctgcagctgctgggtttcatcctggcttctctgggatggatcggc
tccatcgtcagcactgccctgccccagtggaagatttactcctatgctggggacaacatc
gtgaccgctcaggccatctacgagggactgtggatgtcctgcgtttcgcaaagcaccggg
cagatacagtgcaaagtcttcgactccttgctgaatctgaacagtactttgcaggcaacc
cgagccttgatggtaattggcatcctgctggggctgatcgcaatctttgtgtccaccatt
ggcatgaagtgcatgaggtgcctggaagatgatgaggtgcagaagatgtggatggctgtc
attgggggcataatatttttaatttcaggtctggcgacattagtggccacagcatggtat
ggaaacagaattgttcaagaattctatgaccccttgacccccatcaatgccaggtatgaa
tttggccaggccctctttactggctgggccgctgcctccctctgccttctgggaggtgtc
ctactttcctgctcctgtccccggaaaacaacctcttacccaacaccacggccttatccc
aagccaacaccttctagtgggaaagactatgtgtga

KEGG   Mus musculus (mouse): 12738
Entry
12738             CDS       T01002                                 

Gene name
Cldn2, AL022813
Definition
(RefSeq) claudin 2
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12738 (Cldn2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12738 (Cldn2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12738 (Cldn2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12738 (Cldn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12738 (Cldn2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12738 (Cldn2)
  Exosomal proteins of colorectal cancer cells
   12738 (Cldn2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 12738
NCBI-ProteinID: NP_057884
MGI: 1276110
Ensembl: ENSMUSG00000047230
Vega: OTTMUSG00000018734
UniProt: O88552
Position
X; X F1
AA seq 230 aa
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV
GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI
LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggc
acatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcatt
gtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggc
atcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcc
caggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtg
ggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtg
ggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatctt
catggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagatt
ggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatc
ctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcc
cagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgag
ttcaactcatacagcctgactgggtatgtgtga

KEGG   Mus musculus (mouse): 12739
Entry
12739             CDS       T01002                                 

Gene name
Cldn3, AI182374, Cpet, Cpetr2, mRVP1
Definition
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12739 (Cldn3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12739 (Cldn3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12739 (Cldn3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12739 (Cldn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12739 (Cldn3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12739 (Cldn3)
  Exosomal proteins of colorectal cancer cells
   12739 (Cldn3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 12739
NCBI-ProteinID: NP_034032
MGI: 1329044
Ensembl: ENSMUSG00000070473
Vega: OTTMUSG00000022612
UniProt: Q9Z0G9 Q545A5
Structure
PDB: 
6AKE 6AKF 6AKG

Position
5 G2; 5 74.93 cM
AA seq 219 aa
MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcaccggcacgtcgctggccgtgctgggctggctgtgcacc
atcgtgtgctgcgcccttcccatgtggcgcgtttcggccttcatcggcagcagcatcatc
acggcgcagatcacctgggagggcctgtggatgaactgcgtggtgcagagcaccggtcag
atgcagtgcaaaatgtacgactcgctgctggccctgccgcaggacctgcaggccgcccga
gccctcatcgtggtgtccatcctgctggccgccttcgggctcctcgtggcgctcgtgggc
gcccagtgtaccaactgcgtacaagacgagacggccaaggccaagatcaccatcgtggcg
ggagtgcttttcctgttggcggctctgctcaccttagtaccggtgtcctggtcggccaac
accatcatcagggatttctataacccgttggtgcccgaggcccagaagcgggagatggga
gctgggttgtacgtgggctgggctgccgccgcgctgcagttgctagggggcgccttgctg
tgttgctcctgcccaccgcgcgacaagtatgcacccaccaagatcctctattctgcgccg
cgatccaccggccctggcaccggtaccggcaccgcctacgaccgcaaggactacgtctga

KEGG   Mus musculus (mouse): 12740
Entry
12740             CDS       T01002                                 

Gene name
Cldn4, Cep-r, Cpe, Cpet, Cpetr, Cpetr1
Definition
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12740 (Cldn4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12740 (Cldn4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12740 (Cldn4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12740 (Cldn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12740 (Cldn4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12740 (Cldn4)
  Exosomal proteins of colorectal cancer cells
   12740 (Cldn4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 Amastin SUR7
Other DBs
NCBI-GeneID: 12740
NCBI-ProteinID: NP_034033
MGI: 1313314
Ensembl: ENSMUSG00000047501
Vega: OTTMUSG00000055820
UniProt: O35054 Q3UM35
Position
5 G2; 5 74.9 cM
AA seq 210 aa
MASMGLQVLGISLAVLGWLGIILSCALPMWRVTAFIGSNIVTAQTSWEGLWMNCVVQSTG
QMQCKMYDSMLALPQDLQAARALMVISIIVGALGMLLSVVGGKCTNCMEDETVKAKIMIT
AGAVFIVASMLIMVPVSWTAHNVIRDFYNPMVASGQKREMGASLYVGWAASGLLLLGGGL
LCCSCPPRSNDKPYSAKYSAARSVPASNYV
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgtctatgggactacaggtcctgggaatctccttggcagtcctgggctggctgggg
atcatcctgagttgtgcgctccccatgtggcgggtgaccgccttcatcggcagcaacatc
gtcacggcacagaccagctgggagggcctctggatgaactgcgtggtgcagagcacaggt
cagatgcagtgcaagatgtacgactcgatgctcgccctgccgcaggacctgcaggccgcc
cgagcccttatggtcatcagcatcatcgtgggtgctctggggatgcttctctcagtggta
gggggcaagtgcaccaactgcatggaggacgagaccgtcaaggccaagatcatgatcacc
gccggagccgtgttcatcgtggcaagcatgctgattatggtgcccgtgtcctggaccgct
cacaacgtcatccgcgacttctacaaccctatggtggcttccgggcagaagagggaaatg
ggggcctcgctttacgtcggctgggcggcctccgggctgctgctcctgggaggaggcctc
ctctgctgcagttgcccacctcgtagcaacgacaagccctactcggccaagtactccgcc
gcccgctctgtccccgccagcaactatgtgtaa

KEGG   Mus musculus (mouse): 12741
Entry
12741             CDS       T01002                                 

Gene name
Cldn5, AI854493, MBEC1, Tmvc, Tmvcf
Definition
(RefSeq) claudin 5
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    12741 (Cldn5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12741 (Cldn5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    12741 (Cldn5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12741 (Cldn5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12741 (Cldn5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12741 (Cldn5)
  Exosomal proteins of colorectal cancer cells
   12741 (Cldn5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 12741
NCBI-ProteinID: NP_038833
MGI: 1276112
Ensembl: ENSMUSG00000041378
UniProt: O54942
Position
16 A3; 16 11.63 cM
AA seq 218 aa
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG
HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALT
GGALYAVCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGL
VCCGAWVCTGRPEFSFPVKYSAPRRPTANGDYDKKNYV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggatgggtgggc
ttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaacatc
gtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagtaccggg
cacatgcagtgcaaggtgtatgaatctgtgctggcgctgagtgcggaggtgcaggcagct
cgggcactcaccgtgggcgctgtgctgctggcgctggtggcactctttgttaccttgacc
ggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtagcactcacg
ggaggagcgctttacgcggtgtgcgggctgctggcactcgtgccgctctgctggttcgcc
aacatcgttgtccgcgagttctatgatccgacggtgccggtgtcacagaagtacgagctg
ggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgcggtggcggcctc
gtgtgttgcggcgcctgggtctgcaccgggcgccctgagttcagcttcccggtcaagtac
tctgcgccgcggcggcccacggccaatggcgattacgacaagaagaactatgtctaa

KEGG   Mus musculus (mouse): 18260
Entry
18260             CDS       T01002                                 

Gene name
Ocln, AI503564, O, Ocl
Definition
(RefSeq) occludin
  KO
K06088  occludin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18260 (Ocln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    18260 (Ocln)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    18260 (Ocln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    18260 (Ocln)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    18260 (Ocln)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18260 (Ocln)
SSDB
Motif
Pfam: MARVEL Occludin_ELL APG6_N GAS DUF4164 TMF_TATA_bd Laminin_II Swi5 Spc7
Other DBs
NCBI-GeneID: 18260
NCBI-ProteinID: NP_032782
MGI: 106183
Ensembl: ENSMUSG00000021638
Vega: OTTMUSG00000035055
UniProt: Q61146 B2RS24
Position
13 D1; 13 53.23 cM
AA seq 521 aa
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYSGFGYGGGYGGGYG
GYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSAIL
GIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGGTGLYVDQYLYHYCVVDPQ
EAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVS
AGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTLSVD
DFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREYP
PITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAADEY
NRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDRRKP
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgtgaggccttttgaaagtccacctccttacagacctgatgaattcaaacccaat
cattatgcaccaagcaatgacatgtatggcggagagatgcatgtccggccgatgctctct
cagccagcgtactctttttatccggaagatgaaattcttcacttctacaaatggacgtcg
cccccaggggtgatccggatcctgtctatgctcattattgtgatgtgcatcgccatattt
gcctgtgtggcttccacacttgcttgggacagaggctatgggacagggctctttggagga
agcctaaactacccttatagtggctttggctacggaggtggctatggaggcggctatgga
ggctatggctatggctatggcggatatacagacccaagagcagccaaaggcttcctgttg
gccatggcagccttctgcttcatcgcttccttagtaatatttgtgaccagtgttataaga
tctggaatgtccaggacaagaagatattacttgatcgtgatcatagtcagcgctatcctg
ggcatcatggtgtttattgccacgatcgtgtacataatgggagtgaacccgacggcccag
gcttctggatctatgtacggctcacagatatatatgatctgcaaccagttttatactcct
ggaggtactggtctctacgtggatcaatatttgtatcactactgtgtggttgatccccag
gaggctatagccattgtcctggggttcatgattatcgtggcttttgctttaatcatcttt
tttgctgtgaaaacccgaagaaagatggatcggtatgataagtccaatattttgtgggat
aaggaacacatttatgatgaacagccccccaatgttgaagagtgggttaaaaatgtgtct
gcaggcacacaggacatgcctccacccccatctgactatgcggaaagagttgacagtcca
atggcctactcctccaatggcaaagtgaatggcaagcgatcatacccagagtctttctat
aagtcaacacctctggtgcctgaagtggcccaggagattcctctgaccttgagtgtggat
gacttcaggcagcctcggtacagcagcaatggtaacctagagacaccttctaaaagggct
cccacgaaggggaaagcaggaaagggcaagaggacggaccctgaccactatgaaacagac
tacacgacaggtggggagtcctgcgaggagctggaggaggactgggtcagggaatatcca
cctatcacttcagatcaacaaagacaactctacaagagaaattttgatgcaggtctgcag
gagtataagagcttacaggcagaactagacgacgtcaataaagagctctctcgtctagat
aaagagctggatgactacagagaggagagtgaagagtacatggctgctgctgatgaatat
aatagactaaagcaagttaagggatctgcagattataaaagtaagaggaattactgcaag
cagttgaagagcaaattatcgcacatcaagaggatggtgggagattatgacagacggaaa
ccttag

KEGG   Mus musculus (mouse): 18417
Entry
18417             CDS       T01002                                 

Gene name
Cldn11, Claudin-11, Claudin11, Osp, Ot, Otm
Definition
(RefSeq) claudin 11
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18417 (Cldn11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    18417 (Cldn11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    18417 (Cldn11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    18417 (Cldn11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    18417 (Cldn11)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   18417 (Cldn11)
  Exosomal proteins of colorectal cancer cells
   18417 (Cldn11)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 18417
NCBI-ProteinID: NP_032796
MGI: 106925
Ensembl: ENSMUSG00000037625
Vega: OTTMUSG00000022650
UniProt: Q60771
Position
3 A3; 3 15.14 cM
AA seq 207 aa
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSG
DAQSFGENRFYYSSGSSSPTHAKSAHV
NT seq 624 nt   +upstreamnt  +downstreamnt
atggtagccacttgccttcaggtggtgggtttcgtcacgagcttcgtgggttggattggc
atcatcgtcacaacgtccaccaatgactgggtggtgacctgcagctacaccatccccacc
tgccgaaaaatggacgaactgggctccaagggcctgtgggctgactgcgtcatggccact
ggtctctaccactgcaaacccctggtggacatcctcatccttccaggctacgtgcaggct
tgtagagccctcatgattgctgcctccgttctgggcctgcccgccatcttgctgctgttg
acagttctcccctgcatccgaatgggccacgagcctggagtggccaagtacaggcgagcc
cagctggctggggtgctccttattctgctggctctctgcgccattgtcgccaccatctgg
tttcctgtatgtgcccaccgcgagatcaccatcgtgagctttggctactcgctgtacgca
ggttggatcggtgctgtgatgtgcctggtgggtggctgtgtcatcgtctgctgctccggg
gatgcacagtcatttggagaaaaccgtttctattactcttctggttccagctcgccaacg
catgccaagagtgcccatgtctaa

KEGG   Mus musculus (mouse): 239931
Entry
239931            CDS       T01002                                 

Gene name
Cldn17
Definition
(RefSeq) claudin 17
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    239931 (Cldn17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    239931 (Cldn17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    239931 (Cldn17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    239931 (Cldn17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    239931 (Cldn17)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   239931 (Cldn17)
  Exosomal proteins of colorectal cancer cells
   239931 (Cldn17)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 Jiraiya DUF4064
Other DBs
NCBI-GeneID: 239931
NCBI-ProteinID: NP_852467
MGI: 2652030
Ensembl: ENSMUSG00000055811
Vega: OTTMUSG00000019870
UniProt: Q8BXA6
Position
16; 16 C3.3
AA seq 224 aa
MAFYPLQIAGLVLGFFGLVGTIGTTLLPQWRVSAFIGSNIIIFERIWEGLWMNCIQQAMV
TLQCKFYNSILALPPVLEAARALMCVAVALALVALIIGICGMKQLQCTGSSERVKAYLLG
TSGVLFILTGIFVLIPVSWTANIIIRDFYDPTVHAGQKRELGGALFLGWATAAVLFIGGG
LLCGYCCCNRKERWHRYPVPAYRVPQKDNQRNVTVPRKSSTSYV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggctttttatcccttacagatcgctggactagttcttggattcttcggtttggttggg
acgattgggacaacacttctgcctcaatggagagtgtcagctttcatcggcagcaacatt
attatctttgagaggatctgggaagggctttggatgaactgcatccagcaagctatggtc
accttgcagtgcaaattctataactccatattggctctccctccggtactggaagcagcg
cgtgccctcatgtgtgtggctgtggctcttgccttggttgctctcattattggcatctgc
ggcatgaaacagctccagtgcaccggctccagcgagagggtcaaagcctacttgcttgga
acctcaggggtgctctttattctgactggtatcttcgttctgattccagtgtcctggact
gctaatatcatcatcagagatttctacgacccaaccgttcatgcagggcagaagcgagaa
cttggaggagcactcttccttggctgggcaaccgctgctgtcctcttcattggaggcggg
ctgctctgcggatattgctgctgcaacagaaaggaacggtggcacagatacccagtccct
gcataccgcgtgccacagaaggataaccaaaggaatgttactgtgcctagaaaatcttcc
accagctacgtctaa

KEGG   Mus musculus (mouse): 242653
Entry
242653            CDS       T01002                                 

Gene name
Cldn19
Definition
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    242653 (Cldn19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    242653 (Cldn19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    242653 (Cldn19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    242653 (Cldn19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    242653 (Cldn19)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   242653 (Cldn19)
  Exosomal proteins of colorectal cancer cells
   242653 (Cldn19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin Mntp SUR7 Prominin
Other DBs
NCBI-GeneID: 242653
NCBI-ProteinID: NP_001033679
MGI: 3033992
Ensembl: ENSMUSG00000066058
Vega: OTTMUSG00000009224
UniProt: Q9ET38
Structure
PDB: 
3X29

Position
4; 4 D2.1
AA seq 224 aa
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPTAKSRVAI
SGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGS
FLCCTCPEPERANSIPQPYRSGPSTAAREPVVKLPASVKGPLGV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctccagctcctgggctacttcctagccttgggcggctgggtgggc
atcatcgccagcactgccctgccacagtggaagcagtcttcctatgcaggcgatgccatc
atcactgccgtgggcctctacgaagggctgtggatgtcttgcgcctctcagagcaccggg
caggtgcaatgcaaactctacgattcactcctggccctggacggtcatatccagtcagca
cgagccctgatggtcgtggctgtgctcctgggctttgtggccatggtgctcagtgtcgtg
ggcatgaagtgcactcgggttggagacagtaaccccactgccaagagccgtgtggccatc
tccggaggtgctctcttcctcttggcaggtctctgtactttgactgctgtctcctggtat
gctaccctggtaacacaggaattcttcaaccccagcactcctgtcaatgccaggtacgaa
tttggcccagctctgttcgtcggctgggcctcggccggcctggccatgctgggcggttcc
tttctctgctgcacatgcccagagccggagagggcgaacagcatcccacagccctatcgc
tctggaccctcaactgctgccagagaacctgttgttaagttgcccgcctcggtcaagggc
cccctgggtgtgtaa

KEGG   Mus musculus (mouse): 53624
Entry
53624             CDS       T01002                                 

Gene name
Cldn7
Definition
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    53624 (Cldn7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53624 (Cldn7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    53624 (Cldn7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    53624 (Cldn7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    53624 (Cldn7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   53624 (Cldn7)
  Exosomal proteins of colorectal cancer cells
   53624 (Cldn7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Amastin Clc-like DUF1129
Other DBs
NCBI-GeneID: 53624
NCBI-ProteinID: NP_001180548
MGI: 1859285
Ensembl: ENSMUSG00000018569
Vega: OTTMUSG00000006019
UniProt: Q9Z261
Position
11; 11 B3
AA seq 211 aa
MANSGLQLLGFSMAMLGWVGLIASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTG
MMSCKMYDSVLALPGALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKAKKARIAM
TGGIVFIVAGLAALVACSWIGHQIVTDFYNPLTPMNVKYEFGPAIFIGWAGSALVLLGGA
LLSCSCPGSESKAAYRAPRSYPKSNSSKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaactcgggcctgcaactgctgggcttttcaatggccatgcttggctgggtgggc
ctgatagcgagcactgccatccctcagtggcagatgagctcctatgcgggcgacaacatc
atcacagcccaggccatgtacaaggggctctggatggagtgcgtcacgcagagcaccggc
atgatgagctgcaaaatgtacgactcggtgctcgccctgccgggagccctgcaggccact
cgagccttaatggtggtgtccctggtgttgggcttcttagccatgtttgtcgccacgatg
ggcatgaagtgcacacgctgtgggggagatgacaaagcgaagaaggcccgaatagctatg
actggaggcattgttttcattgtggcaggtcttgctgccttggtagcatgttcctggatt
ggtcatcagattgtcacagacttttataaccccttgacgcccatgaacgttaagtacgag
tttggacctgccatctttatcggctgggcagggtctgctctggtccttctgggaggtgcc
ctgctctcttgctcctgtccaggcagtgaaagcaaagctgcgtaccgagcaccccgctct
taccccaagtccaattcctccaaggaatacgtgtga

KEGG   Mus musculus (mouse): 54419
Entry
54419             CDS       T01002                                 

Gene name
Cldn6, AL024037
Definition
(RefSeq) claudin 6
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54419 (Cldn6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54419 (Cldn6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    54419 (Cldn6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    54419 (Cldn6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    54419 (Cldn6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   54419 (Cldn6)
  Exosomal proteins of colorectal cancer cells
   54419 (Cldn6)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF5368
Other DBs
NCBI-GeneID: 54419
NCBI-ProteinID: NP_061247
MGI: 1859284
Ensembl: ENSMUSG00000023906
Vega: OTTMUSG00000033036
UniProt: Q9Z262 Q0GH64
Position
17; 17 A3.3
AA seq 219 aa
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLI
SGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGL
LCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcctctactggtctgcaaatcttggggatcgtcctgaccctgcttggctgggtcaac
gccctggtgtcctgtgccctgcccatgtggaaggtgaccgccttcatcggcaacagcatc
gtcgtggcccagatggtgtgggaggggctgtggatgtcctgtgtggttcagagcactggc
cagatgcagtgcaaggtgtatgactcactgttggcgctgccccaggacctgcaggctgcc
agagccctctgtgttgtcaccctcctcattgtcctgcttggcctgctcgtgtacctggct
ggagccaagtgcactacctgtgtggaagataggaactccaagtctcgtctggtgctcatc
tctggcatcatctttgtcatttctggggtcctgacgctcattcctgtctgctggactgcc
cactctatcatccaggacttctacaaccccttggtggctgatgctcaaaagcgggagctg
ggggcctccctctacctgggctgggcagcctcaggccttttgctgctgggtggagggcta
ctatgctgcgcctgctcttctggagggacccagggacccagacattacatggcctgctat
tctacatctgtcccacattctcggggaccctccgaatatcccaccaagaattatgtgtga

KEGG   Mus musculus (mouse): 54420
Entry
54420             CDS       T01002                                 

Gene name
Cldn8, AI648025
Definition
(RefSeq) claudin 8
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54420 (Cldn8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54420 (Cldn8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    54420 (Cldn8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    54420 (Cldn8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    54420 (Cldn8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   54420 (Cldn8)
  Exosomal proteins of colorectal cancer cells
   54420 (Cldn8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like FtsX
Other DBs
NCBI-GeneID: 54420
NCBI-ProteinID: NP_061248
MGI: 1859286
Ensembl: ENSMUSG00000050520
Vega: OTTMUSG00000019871
UniProt: Q9Z260 Q3UZK2
Position
16; 16 C3.3
AA seq 225 aa
MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANI
RMQCKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILL
TAGIIFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGA
LFCCVFCCTERSNSYRYSVPSHRTTQRSFHAEKRSPSIYSKSQYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcaacctacgctcttcaaatggctgcactggtgcttggtggtgttggcatggtgggc
acggtggctgtgactatcatgcctcagtggagagtgtctgccttcatcgaaagtaacatt
gtggtgtttgagaaccgctgggaaggcttgtggatgaattgtatgaggcatgccaacatc
agaatgcagtgcaaggtctacgactccctgctggctcttagtccagacctccaggcatcc
cgaggactgatgtgtgctgcgtccgtcttggctttcttggctttcatgacagccatcctc
ggaatgaagtgcaccagatgcacgggggacgatgagaacgtgaagagccgcatcttgctg
acagccggaatcatcttcttcatcaccggcttggttgtgctcatccctgtcagctgggtt
gccaattccatcatcagagacttctacaacccactggtggatgtggccctaaagcgcgag
ctgggagaagccctctacataggctggaccacagcgctggtgctgatcgctggaggagca
ctgttctgttgtgtgttttgttgtactgaaaggagcaacagttacaggtactcggtacca
tcccatcgcaccactcaacggagtttccacgccgaaaagagatctccgagcatatactcc
aaaagtcagtatgtgtag

KEGG   Mus musculus (mouse): 56173
Entry
56173             CDS       T01002                                 

Gene name
Cldn14, AI851731
Definition
(RefSeq) claudin 14
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    56173 (Cldn14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56173 (Cldn14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    56173 (Cldn14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56173 (Cldn14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56173 (Cldn14)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   56173 (Cldn14)
  Exosomal proteins of colorectal cancer cells
   56173 (Cldn14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin DGF-1_C Laminin_EGF
Other DBs
NCBI-GeneID: 56173
NCBI-ProteinID: NP_001159397
MGI: 1860425
Ensembl: ENSMUSG00000047109
Vega: OTTMUSG00000019962
UniProt: Q9Z0S3 A2RSP0
Position
16; 16 C4
AA seq 239 aa
MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVL
GGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTL
LCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccagcacagcggtccagctcctaggcttcctgcttagcttcctgggcatggtagga
acgctcatcaccaccatcctgccacactggcggaggacggcccatgtgggcaccaacatc
ctgactgccgtatcctacctgaagggactgtggatggaatgtgtgtggcacagcacaggc
atctaccagtgtcagatctaccgctcactgctggcgctgccccgggacttgcaggccgcc
cgggcgctcatggtcatctcctgcctgttgtcgggcatggcctgcgcctgcgcagtagtg
ggcatgaagtgcacacgctgcgccaaaggcacacccgccaagaccacctttgcagtgctg
gggggcgcgctcttcctgctggccggcctgctgtgcatggtggccgtgtcctggaccacg
aatgacgtggtgcagaatttttataacccgctgctgcccagtggcatgaagtttgaaatc
ggccaggccctgtacctgggcttcatctcctcatccctgtctctcatcgggggcaccctg
ctctgcttatcctgccaggacgaggccccctacagaccctacccgccccagtccagggcc
ggagctaccaccacggctaccgcccctgcctaccgcccaccagcggcctacaaggacaac
cgtgccccctcggtgacctcagccgcgcacagtgggtacaggctgaatgactacgtgtga

KEGG   Mus musculus (mouse): 56492
Entry
56492             CDS       T01002                                 

Gene name
Cldn18
Definition
(RefSeq) claudin 18
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    56492 (Cldn18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56492 (Cldn18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    56492 (Cldn18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56492 (Cldn18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56492 (Cldn18)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   56492 (Cldn18)
  Exosomal proteins of colorectal cancer cells
   56492 (Cldn18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064
Other DBs
NCBI-GeneID: 56492
NCBI-ProteinID: NP_001181850
MGI: 1929209
Ensembl: ENSMUSG00000032473
Vega: OTTMUSG00000028913
UniProt: P56857 Q8BZS5
Position
9; 9 E3.3
AA seq 264 aa
MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGF
TECRGYFTLLGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT
SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV
GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN
KKIYDGGARTEDDEQSHPTKYDYV
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtcggtgaccgcctgccagggcttggggtttgtggtgtcactgatcgggtttgcgggc
atcattgcagccacttgtatggaccagtggagcacccaggatttatacaacaacccggtg
accgctgtattcaactaccaagggctatggcgttcatgcgtccgagagagctctggcttc
accgagtgccgaggctacttcaccctgttggggttgccagccatgctgcaagctgtacga
gccctgatgatcgtgggcattgttctgggggtcatcggtatcctcgtgtccatcttcgcc
ctgaagtgcattcgcattggtagcatggatgactctgccaaggccaagatgactctgact
tctgggatcttgttcatcatctccggcatctgtgcaatcattggtgtgtctgtgtttgcc
aacatgctggtgaccaacttctggatgtccacagctaacatgtacagcggcatgggcggc
atgggtggcatggtgcagaccgttcagaccaggtacacctttggtgcagctctgttcgtg
ggctgggttgctggaggcctcaccctgattgggggagtgatgatgtgcatcgcctgccgt
ggcctgacaccagatgacagcaacttcaaagctgtgtcttaccatgcctctggccaaaat
gttgcctacaggcctggaggctttaaggccagcactggctttgggtccaacaccagaaac
aagaagatctacgatgggggtgcccgcacagaagacgatgaacagtctcatcctaccaag
tatgactatgtgtag

KEGG   Mus musculus (mouse): 56863
Entry
56863             CDS       T01002                                 

Gene name
Cldn9, nmf32, nmf329
Definition
(RefSeq) claudin 9
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    56863 (Cldn9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56863 (Cldn9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    56863 (Cldn9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56863 (Cldn9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56863 (Cldn9)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   56863 (Cldn9)
  Exosomal proteins of colorectal cancer cells
   56863 (Cldn9)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872
Other DBs
NCBI-GeneID: 56863
NCBI-ProteinID: NP_064689
MGI: 1913100
Ensembl: ENSMUSG00000066720
Vega: OTTMUSG00000033035
UniProt: Q9Z0S7
Position
17; 17 A3.3
AA seq 217 aa
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctagga
actttggtgtcctgtgccctgccactgtggaaggtgaccgccttcatcggcaacagcatc
gttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactggc
cagatgcagtgcaaagtatacgactcactgctggcgctgccccaggacctgcaggcagcc
agagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacg
ggcgcccagtgcaccacgtgtgtggaggacgaaggtgccaaggcccgtatcgtactcacc
gcaggggtcctcctcctcctctcgggcattttggtgctcatccctgtctgctggacagcc
catgccatcatccaggatttttataacccactggttgcggaagccctcaagagagaactg
ggggcttccctctacctgggctgggctgccgctgccctgctcatgctagggggagggctc
ctctgctgtacgtgtcccccgtcacactttgagcgtccccgcggccccaggctgggctac
tccatcccttcccgttcaggtgcttcgggactggataagagggactatgtgtga

KEGG   Mus musculus (mouse): 57255
Entry
57255             CDS       T01002                                 

Gene name
Cldn13, 2500004B14Rik
Definition
(RefSeq) claudin 13
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    57255 (Cldn13)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    57255 (Cldn13)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    57255 (Cldn13)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    57255 (Cldn13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    57255 (Cldn13)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   57255 (Cldn13)
  Exosomal proteins of colorectal cancer cells
   57255 (Cldn13)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 PIRT
Other DBs
NCBI-GeneID: 57255
NCBI-ProteinID: NP_065250
MGI: 1913102
Ensembl: ENSMUSG00000008843
Vega: OTTMUSG00000025978
UniProt: Q9Z0S4 Q547B2
Position
5; 5 G2
AA seq 211 aa
MVVSKQEAISFSVTSLGWVGAIVSCVLPVWRVTFPDDETDPDATIWEGLWHICQVRENRW
IQCTLYDTRILVAQDIKVSRVFMVICTIGTWLGLLLCVLGDWRINCFMNFTIEENLLKVA
GGMFLSVGLLMLVPLSWVTHNIIHGFFNPLLGFSKKVQMGSSLSLAWTSSLLLLLGGILL
CVNIPVCRDFPRCIETPSARPSGANNDTLDV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggtcgtcagcaaacaagaggccatcagcttctctgtgacttcactgggttgggtgggt
gccattgtgagctgcgtgctgcccgtttggagggtgacctttccagatgatgagacagac
ccagatgccaccatttgggagggtctgtggcacatatgccaggttcgggaaaacaggtgg
atacagtgtacactgtatgacacccggatactggtagcacaggacataaaagtgtctcga
gtctttatggtcatctgtaccattggaacctggctgggattgctgctctgtgtgcttggg
gattggcgcatcaattgtttcatgaattttactattgaagagaacctcttgaaagtagcc
ggtgggatgtttcttagtgttggccttctgatgctggtacccctgtcctgggtaacacac
aacatcatccatggcttctttaacccattgcttggcttctcgaagaaagtacagatgggc
tcttcactctccctggcctggaccagctccctgctgctgttgctgggaggcatcctgctc
tgtgtcaacatcccagtatgcagagactttccccgttgcattgagacccctagtgctaga
ccttcaggagccaacaacgataccttagatgtttga

KEGG   Mus musculus (mouse): 58187
Entry
58187             CDS       T01002                                 

Gene name
Cldn10, 6720456I16Rik, Cldn, Cldn1, Cldn10a, Cldn10b, D14Ertd728, D14Ertd728e
Definition
(RefSeq) claudin 10
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    58187 (Cldn10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    58187 (Cldn10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    58187 (Cldn10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    58187 (Cldn10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    58187 (Cldn10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   58187 (Cldn10)
  Exosomal proteins of colorectal cancer cells
   58187 (Cldn10)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 YccF
Other DBs
NCBI-GeneID: 58187
NCBI-ProteinID: NP_067361
MGI: 1913101
Ensembl: ENSMUSG00000022132
Vega: OTTMUSG00000023307
UniProt: Q9Z0S6
Position
14 E4; 14 62.55 cM
AA seq 231 aa
MASTALEIVAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKICVTDSTGV
ANCKEFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKYELGAALFIGWAGASLCIIGGVIFC
FSISDNNKTPRMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV
NT seq 696 nt   +upstreamnt  +downstreamnt
atggctagcacggccttggaaatcgtcgccttcgtagtctccatctcgggctgggtgcta
gtgtcttccacactgcccaccgactactggaaggtctccaccatcgatggcactgtcatc
accacagccacttattttgccaacctgtggaagatctgcgttaccgattccaccggtgtc
gccaactgcaaggagttcccctccatgctggcgttggatggttacatccaggcatgtaga
ggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttgga
atgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggcc
gggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaac
aaaatcacaacagaattctttgatcctctttatatggagcaaaagtatgaattaggggct
gctctcttcatcggatgggcaggagcttctctctgcatcattgggggagtcatattttgc
ttttcaatatccgacaacaacaagacacccagaatgggctacacatacaacggacccacg
tctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggc
ccttcaaaacagtttgataaaaatgcctatgtctaa

KEGG   Mus musculus (mouse): 60363
Entry
60363             CDS       T01002                                 

Gene name
Cldn15, 2210009B08Rik, BB107105
Definition
(RefSeq) claudin 15
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    60363 (Cldn15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    60363 (Cldn15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    60363 (Cldn15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    60363 (Cldn15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    60363 (Cldn15)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   60363 (Cldn15)
  Exosomal proteins of colorectal cancer cells
   60363 (Cldn15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 60363
NCBI-ProteinID: NP_068365
MGI: 1913103
Ensembl: ENSMUSG00000001739
Vega: OTTMUSG00000023395
UniProt: Q9Z0S5
Structure
PDB: 
4P79

Position
5; 5 G2
AA seq 227 aa
MSVAVETFGFFMSALGLLMLGLTLSNSYWRVSTVHGNVITTNTIFENLWYSCATDSLGVS
NCWDFPSMLALSGYVQGCRALMITAILLGFLGLFLGMVGLRCTNVGNMDLSKKAKLLAIA
GTLHILAGACGMVAISWYAVNITTDFFNPLYAGTKYELGPALYLGWSASLLSILGGICVF
STCCCSSKEEPATRAGLPYKPSTVVIPRATSDESDISFGKYGKNAYV
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtcggtagctgtggagaccttcggcttcttcatgtcagccctgggactgctgatgctg
gggttgaccctttcaaacagctactggagagtgtctacggtccatggcaacgtcatcacc
accaacaccatctttgagaacctgtggtacagctgtgccaccgactccctgggagtctcc
aactgctgggactttccgtccatgctggccctctctgggtatgtccagggctgccgggct
ctcatgatcaccgccatcctcctgggcttcctgggcctctttctaggcatggtgggactc
cgctgcaccaacgtgggcaacatggatctctccaagaaggccaagctgctggccattgca
gggaccctccacatacttgctggagcctgtgggatggtggctatctcgtggtacgccgtc
aacatcactactgacttcttcaacccactgtatgctggaaccaagtatgaactgggcccc
gccctctacttgggctggagtgcctccctgctctccatcctgggcggcatctgtgtcttc
tccacctgctgctgttcctccaaggaggaaccagccaccagggctgggcttccctacaag
ccttctacggttgtgataccccgtgccacctcggatgagagtgacatcagcttcggtaaa
tatggcaaaaacgcatacgtgtag

KEGG   Mus musculus (mouse): 621628
Entry
621628            CDS       T01002                                 

Gene name
Cldn20, EG621628
Definition
(RefSeq) claudin 20
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    621628 (Cldn20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    621628 (Cldn20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    621628 (Cldn20)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    621628 (Cldn20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    621628 (Cldn20)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   621628 (Cldn20)
  Exosomal proteins of colorectal cancer cells
   621628 (Cldn20)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 621628
NCBI-ProteinID: NP_001095030
MGI: 3646757
Ensembl: ENSMUSG00000091530
UniProt: G5E8X0
Position
17; 17 A1
AA seq 219 aa
MASAGLQLLAFILAVSGVSGVLAATLLPNWKVNAYAGPNIVTAVVQVQGLWVDCTWYSTG
MFSCTLKYSILSLPVHVQTARATMVLACVLSAWGICTSIAGMNCTHLGGDTHTKSKISFA
GGVCFITAGISGLIPTVWYTKEIIANFLDLTIPESHKYEPGGALYIGFISAMLLLISGVI
FCTSYIQKNQEPWIYPPKQKLSTTWQPKNRRAHNLKDYM
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcctcggcaggtctccagctccttgctttcatcctggccgtgtctggggtgtctgga
gtactcgctgccactctgctgccaaactggaaggttaatgcatacgcaggacccaacatt
gtaactgctgttgtccaggtgcaggggttgtgggtggactgcacgtggtacagcactggg
atgtttagctgcactctaaaatactccattctgtcgctccccgtccatgtgcagactgcg
agggccaccatggtcctggcctgtgttctgtctgcttgggggatttgtacttcgatagca
ggaatgaactgcactcacttaggaggagacacacacaccaagagtaaaatttcctttgct
ggaggagtctgcttcatcactgcagggatctctggtttaatcccaacagtgtggtacacc
aaggagatcatagcgaactttctggatctgaccattccggaaagccacaaatatgaacct
ggaggagccctgtacattgggtttatttcggcgatgctactacttatctctggtgttatt
ttctgcacttcttatatacagaagaaccaagaaccatggatctaccctcccaagcagaaa
ctttccactacctggcagccaaagaacaggcgagcacataacttgaaggattacatgtaa

KEGG   Mus musculus (mouse): 628893
Entry
628893            CDS       T01002                                 

Gene name
Cldn34-ps, EG628893, Gm6927
Definition
(RefSeq) claudin 34, pseudogene
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    628893 (Cldn34-ps)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    628893 (Cldn34-ps)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    628893 (Cldn34-ps)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    628893 (Cldn34-ps)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    628893 (Cldn34-ps)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   628893 (Cldn34-ps)
  Exosomal proteins of colorectal cancer cells
   628893 (Cldn34-ps)
SSDB
Motif
Pfam: Claudin_2 DUF996 DUF4293
Other DBs
NCBI-GeneID: 628893
NCBI-ProteinID: NP_001095055
MGI: 3645962
Ensembl: ENSMUSG00000087152
Position
X; X B
AA seq 212 aa
MLLLSKSANCQVGGFALASIAWVLCSISTGLPQWRVWYLNETMFTEPTTVFIGMWRVCIY
HQNSKFGSARVCHGYTYDDSFIPLDVHIVQHLLLISSMLGLIGTVATIFALRKVYAGKVQ
KNTTHNPFVLSAILNIIASIFLLLAVLFNYLSVVHKAGIAFPPSFHLPLYPPSQRIGIAS
IIASLCALMFLGSGIIFISYTSPVEKQVFPEI
NT seq 639 nt   +upstreamnt  +downstreamnt
atgttgttgctcagcaaaagtgccaactgccaagtcggaggttttgctttggcatccata
gcatgggtactctgcagcatctctacaggcctcccacagtggcgagtctggtacttaaat
gaaacaatgtttactgagcctaccacagtctttataggaatgtggcgagtctgcatttat
caccaaaacagcaaatttggcagtgccagagtgtgccatggatacacctacgatgacagc
tttatccctttggatgttcatattgttcaacacttgttactgatctccagcatgctcgga
ttgattggaacagttgccaccatttttgctcttcgaaaggtgtatgcagggaaagtacag
aagaataccacccacaatccatttgtcctttcagccattcttaacatcattgccagtatc
tttctcctccttgctgtcttattcaactacttatctgtcgttcacaaagcaggaattgcc
ttcccaccatctttccatctgccattatatccacctagtcagagaattggaattgctagt
ataatagccagtctatgtgctctcatgtttttaggcagtggcatcattttcatttcttac
acttctcccgtagaaaaacaagtgtttcctgagatttga

KEGG   Mus musculus (mouse): 69524
Entry
69524             CDS       T01002                                 

Gene name
Esam, 2310008D05Rik, Esam1, W117m
Definition
(RefSeq) endothelial cell-specific adhesion molecule
  KO
K06787  endothelial cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    69524 (Esam)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    69524 (Esam)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set Ig_6 RTX Izumo-Ig Nitrate_red_gam
Other DBs
NCBI-GeneID: 69524
NCBI-ProteinID: NP_081378
MGI: 1916774
Ensembl: ENSMUSG00000001946
Vega: OTTMUSG00000033362
UniProt: Q925F2 Q3U102
Position
9; 9 A4
AA seq 394 aa
MILQAGTPETSLLRVLFLGLSTLAAFSRAQMELHVPPGLNKLEAVEGEEVVLPAWYTMAR
EESWSHPREVPILIWFLEQEGKEPNQVLSYINGVMTNKPGTALVHSISSRNVSLRLGALQ
EGDSGTYRCSVNVQNDEGKSIGHSIKSIELKVLVPPAPPSCSLQGVPYVGTNVTLNCKSP
RSKPTAQYQWERLAPSSQVFFGPALDAVRGSLKLTNLSIAMSGVYVCKAQNRVGFAKCNV
TLDVMTGSKAAVVAGAVVGTFVGLVLIAGLVLLYQRRSKTLEELANDIKEDAIAPRTLPW
TKGSDTISKNGTLSSVTSARALRPPKAAPPRPGTFTPTPSVSSQALSSPRLPRVDEPPPQ
AVSLTPGGVSSSALSRMGAVPVMVPAQSQAGSLV
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgattcttcaggctggaacccccgagaccagcttgctgcgggttttgttcctgggactg
agtacccttgctgccttctcccgagctcagatggagttgcacgtgcccccgggcctcaac
aaattggaagcggtagagggagaagaagtggtgctccccgcctggtacacgatggcacgg
gaggagtcgtggtcccacccccgggaggtgcccatcctgatctggttcttggaacaagaa
gggaaggaaccaaaccaggtgttgtcttacattaatggagtcatgacaaataaacctgga
acagccctggtccactctatctcttcacggaatgtgtccctgcgcctgggggcactccag
gagggagactctgggacttaccgctgttctgtcaatgtgcagaatgatgaaggcaaaagt
ataggccacagcatcaaaagcatagagctcaaagtgctggttcctccagctcctccatcc
tgtagtttacagggtgtaccctatgtcgggaccaatgtgaccctgaactgcaagtcccca
aggagtaaacctactgctcagtaccagtgggagaggctggccccatcctcccaggtcttc
tttggaccagccttagatgctgttcgtggatctttaaagctcactaacctttccattgcc
atgtctggagtctatgtctgcaaggctcaaaacagagtgggctttgccaagtgcaacgtg
accttggacgtgatgacagggtccaaggctgcagtggtcgctggagcagttgtgggcact
tttgttgggttggtgctgatagctgggctggtcctgttgtaccagcgccggagcaagacc
ttggaagagctggccaatgatatcaaggaagatgccattgctccccggaccttgccttgg
accaaaggctcagacacaatctccaagaatgggacactttcttcggtcacctcagcacga
gctctgcggccacccaaggctgctcctccaagacctggcacatttactcccacacccagt
gtctctagccaggccctgtcctcaccaagactgcccagggtagatgaacccccacctcag
gcagtgtccctgaccccaggtggggtttcttcttctgctctgagccgcatgggtgctgtg
cctgtgatggtgcctgcacagagtcaggctgggtctcttgtgtga

KEGG   Mus musculus (mouse): 71908
Entry
71908             CDS       T01002                                 

Gene name
Cldn23, 2310014B08Rik
Definition
(RefSeq) claudin 23
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    71908 (Cldn23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    71908 (Cldn23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    71908 (Cldn23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    71908 (Cldn23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    71908 (Cldn23)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   71908 (Cldn23)
  Exosomal proteins of colorectal cancer cells
   71908 (Cldn23)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF872 Yip1 L_HMGIC_fpl DUF202 DUF4131
Other DBs
NCBI-GeneID: 71908
NCBI-ProteinID: NP_082274
MGI: 1919158
Ensembl: ENSMUSG00000055976
Vega: OTTMUSG00000061042
UniProt: Q9D7D7 Q3ULX4
Position
8; 8 A4
AA seq 296 aa
MRTPVVMTLGMVLTPCGLLLNLVSTLAPGWRLVKGFLDQPVDVVLYQGLWDICREQSSRE
RECGQPDEWNYFQTQPVQVARGLMITSLATTALGLLLASLGVRCWQDEPHYGLAGLSGVV
FFVAGLFSLIPVSWYNHFLSDPDVLAAPSSPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
FAPWCEERCRRCRKAPPAGPRRSSISTVYVDWPEPALTPAIKYYSDGQHRPPPTAEHRDT
SKLKVGFPMPRPPPKSYTNPMDVLEGEEKKTATSQGGSSSRSTRPCQNSLPCDSDL
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgctcacgccctgcgggttgctgctt
aatcttgtcagtacactggccccgggctggcggctggtgaagggctttctggaccagcca
gtggacgtggtgctgtaccaggggctgtgggacatatgtcgcgagcagagcagtcgcgaa
cgcgagtgcggccagcccgacgagtggaactacttccagacccagcctgtgcaggtggcc
cggggactcatgatcacgtcactggccactaccgccctagggctgctgctggcttccctc
ggtgtgcgctgttggcaagatgagccccactacgggctagcgggcctctctggcgtggtg
tttttcgtcgctggcctcttcagcctcatcccggtctcctggtataaccacttcttgtca
gatcccgacgtcctggccgccccgagctcgccggtcacggtgcaggtcagctacagcctg
gtgctgggctacctaggcagctgcctgctgcttctgggcggcttctctctggcgctcagc
tttgcgccctggtgtgaagagcgttgtcgccgctgtcgcaaggcgcccccagcaggcccg
cgccgcagcagcatcagcaccgtctacgtggactggccggaaccagcgctcacacctgcc
atcaagtactacagcgacggacagcatcggcctcctcccaccgcagagcacagggacacc
agcaagctcaaggttggattcccgatgccacgaccgccacccaagtcctacaccaacccg
atggatgtgcttgagggagaagaaaagaagacagccacctcccaaggtggttcctcctct
cgcagcactcggccctgccaaaattcgctgccctgtgactccgacctgtag

KEGG   Mus musculus (mouse): 73934
Entry
73934             CDS       T01002                                 

Gene name
Cldn34c4, 4930412D23Rik
Definition
(RefSeq) claudin 34C4
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    73934 (Cldn34c4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    73934 (Cldn34c4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    73934 (Cldn34c4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    73934 (Cldn34c4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    73934 (Cldn34c4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   73934 (Cldn34c4)
  Exosomal proteins of colorectal cancer cells
   73934 (Cldn34c4)
SSDB
Motif
Pfam: Claudin_2 Cytochrom_B_N_2
Other DBs
NCBI-GeneID: 73934
NCBI-ProteinID: NP_001268466
MGI: 1921184
Ensembl: ENSMUSG00000043569
Vega: OTTMUSG00000018649
UniProt: A2ANA3
Position
X; X E3
AA seq 212 aa
MVFFNKSANYQIRGFALATIAWIMCSTSMGLPEWRIWYFEEPMVSSPNMAFIGMWRASIC
NHVDNSSHKSVCQHYSYHDALVPLDIRLAQHLLLVANIIGLIGTVCAVFALQQLYTEKLE
TNNDDNPFLLSAVLNAVASTFIFLAVMCNFYSVPGKEGLSFLLSLQMPVFPYAQRAGSAM
GVASISALLFLLSALSFISYSPSMEKGKIPLV
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtcttcttcaacaagtctgccaattaccaaataagaggtttcgccttggccaccatt
gcatggataatgtgcagcacatctatgggccttccagaatggcgaatttggtatttcgag
gaacccatggtttcctccccaaacatggcttttataggtatgtggagggccagtatctgc
aaccacgttgacaactccagccacaagagtgtttgccagcactactcctaccatgatgcc
ctcgttcctttggacattcggttagcgcaacatctgctcctggttgcaaacattattggt
ctgattgggacagtttgtgctgtctttgctctacagcagttatacacagagaaactggag
acaaataatgacgacaatccatttcttctttcagctgttctcaacgctgttgctagcacc
tttatttttcttgctgttatgtgtaatttctactctgtgcccggcaaggaagggttaagt
ttcctgctttctttacaaatgccagtttttccatatgctcaaagagcaggaagtgccatg
ggagtggcaagcatatctgcactattgtttttattaagtgcattaagttttatttcttac
agtccttcaatggaaaaagggaaaattccccttgtttga

KEGG   Mus musculus (mouse): 74987
Entry
74987             CDS       T01002                                 

Gene name
Cldn34d, 4930468A15Rik
Definition
(RefSeq) claudin 34D
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    74987 (Cldn34d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    74987 (Cldn34d)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    74987 (Cldn34d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    74987 (Cldn34d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    74987 (Cldn34d)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   74987 (Cldn34d)
  Exosomal proteins of colorectal cancer cells
   74987 (Cldn34d)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin
Other DBs
NCBI-GeneID: 74987
NCBI-ProteinID: NP_001188324
MGI: 1922237
Ensembl: ENSMUSG00000079525
Vega: OTTMUSG00000017769
UniProt: A2AGU5
Position
X; X A7.3
AA seq 210 aa
MARKHAKWQIGGFAAGAIAWFLCIVSMGLPQWRVWFFQDPMDSKHGMTLVGMWKTCIYHQ
ESNSTFNRMCYKYTYQDDFIPLDIRVAQHLLLIASFLGIIATISVIIALWKLNSGRLRKK
ATFNPFRLPGILNIIASSFVFLSILYNYLSIIRKDGIAFPPSFHTPSFPDHQKIGTALAM
ATLSCFLFLVGGIIPLSFTLPPRSRVRYTI
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccagaaagcatgccaaatggcagataggaggttttgctgcaggcgccatagcatgg
ttcctttgtattgtctctatgggcctccctcaatggcgagtatggttctttcaagatccc
atggattccaagcatggcatgaccttagtaggcatgtggaaaacctgcatttaccaccag
gaaagcaattccacctttaaccggatgtgttacaaatacacctaccaggatgacttcatc
cctctggatattcgagttgcccaacatctgctactcatcgcaagctttcttggcattatt
gccacaatctctgtcatcattgctctttggaaattgaactcagggagactccggaagaaa
gctaccttcaatccattccgtcttccaggaattctgaacatcattgctagcagctttgtc
tttctttccatcttgtacaattacttatcgatcattcgcaaggatgggattgccttcccc
ccgtctttccacacaccctccttcccagatcatcaaaaaattggcactgcactggcaatg
gcaactctatcctgtttcttatttctagtgggtggaataattcccctttctttcactctt
cccccacgttcccgagtgcgctatactatttaa

KEGG   Mus musculus (mouse): 75677
Entry
75677             CDS       T01002                                 

Gene name
Cldn22, 2210404A22Rik, 5330431C14Rik, 9530051B05Rik
Definition
(RefSeq) claudin 22
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    75677 (Cldn22)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    75677 (Cldn22)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    75677 (Cldn22)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    75677 (Cldn22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    75677 (Cldn22)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   75677 (Cldn22)
  Exosomal proteins of colorectal cancer cells
   75677 (Cldn22)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 75677
NCBI-ProteinID: NP_083659
MGI: 1922927
Ensembl: ENSMUSG00000038064
Vega: OTTMUSG00000061830
UniProt: Q9D7U6
Position
8; 8 B1.1
AA seq 220 aa
MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMENWTMGLWKSCVIQEEV
GRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDCLRLGETQEGLKKRLLT
LGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFGEALFLGWFAGFCLVLGG
CVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI
NT seq 663 nt   +upstreamnt  +downstreamnt
atgggcttagtcttccgaacggcaacgcaggcggctgcacttctgctctccctgctggga
tgggttttatcctgccttacaaactacttgccgcactggaagaaccttaacttggagctg
aacgagatggagaactggaccatggggctctggaaatcctgcgtcatccaggaggaagtc
gggaggcaatgcaaggactttgactccttcctggccttgccagctgaactgcaggtctcc
agggtcttgatgtccctgtgcaacgggctggggctgctgggcttgctggcctctggctgt
ggcctggactgcttgaggcttggagagacacaggagggtctgaagaagcggctgctcacc
ctgggagggaccctgctctggacctcgggagtcatggtgctagttcctgtctcctgggtg
gcccacaagacggtgcgggagttctgggatgagaccatgcctgagattgtgcccaggtgg
gagtttggggaggccctgttcctgggctggtttgctggcttctgcctggtgctaggaggg
tgtgtgcttcactgtgcagcctgctggagcccggctcctgcagcctcgagtcactatgca
gtggcgggacctcgagaccaccagcagcatctggagctgaagcaagccaatccagaaatc
taa

DBGET integrated database retrieval system