KEGG   Mus musculus (mouse): 100040714
Entry
100040714         CDS       T01002                                 

Gene name
Gm20851
Definition
(RefSeq) predicted gene, 20851
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Spin-Ssty
Other DBs
NCBI-GeneID: 100040714
NCBI-ProteinID: XP_011248182
MGI: 5434207
Ensembl: ENSMUSG00000104439
UniProt: A0A0A6YXW2
Position
Y; Y A1
AA seq 232 aa
MSSLMKKRRRKSSSNTLRNIVGCRISHSWKEGNEPVTQWKAIVLDQLPTNPSLYLVKYDG
IDSIYGLELYSDDRILNLKVLPPIVVFPQVRDAHLARALVGRAVQHKFEGKDGSEVNWRG
VVLAQVPIMKDLFYITYKKDPALYAYQLLDDYKEGNLHMIPDTPPAEERSGDDSDVLIGN
WVEYTRKDGSKKFGKVVYQVLANPSVYFIKFHGDIHIYVYTMVPKIFKVEKS
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtcatccctcatgaagaagaggaggaggaagtcttcttccaacaccctgaggaatatt
gtcggctgcagaatttctcacagttggaaggaaggtaatgagcctgtcacccaatggaag
gccatagttctagatcaactgccaacaaacccttctctttacttggtgaagtatgatgga
attgacagcatctacggactggagctctacagtgatgacaggattttaaaccttaaggtt
ttgcctcccatagtagtatttcctcaggtgagggatgcccacctcgccagagccctggtt
ggcagagcggtacaacacaaatttgaggggaaagatggctctgaggtcaactggaggggg
gtggtgctagcccaggtgccaatcatgaaggatttgttttacattacctacaagaaggat
ccagctctctatgcttatcagctcctggatgactacaaggaaggtaacctccacatgatt
ccagacactcctccggctgaggagagatcaggagatgacagtgatgtgttgattggtaac
tgggtggaatacaccagaaaagatggttccaaaaagttcggaaaggttgtttaccaagtt
ctagccaatccttccgtgtactttatcaagtttcatggtgacatccatatctatgtctat
actatggtgccaaagatttttaaagttgaaaaatcataa

DBGET integrated database retrieval system