KEGG   Mus musculus (mouse): 100040981Help
Entry
100040981         CDS       T01002                                 

Gene name
Gm16429, EG666089
Definition
(RefSeq) predicted gene 16429
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FTH LRR_4
Motif
Other DBs
NCBI-GeneID: 100040981
NCBI-ProteinID: XP_001476078
MGI: 3704105
Ensembl: ENSMUSG00000096230
Vega: OTTMUSG00000055698
UniProt: J3QMM8
Position
5; 5 E3
AA seq 481 aa AA seqDB search
MSVQTPSTLQNLTLKALLRDEALALSCLEEVPFLLFPALFKEAFAGRLKKLMKAIVAAWT
FPCLPVGALMKSPNLETLQAVLDGIDMQLTRKSHPRGKLQVLDLRNVHHAFWDIWAGAED
GSCSSESLNEKPTVVKVLRRYARRKQLKVVADLCLRPRRDEAQAYFLKWAQQRKDSLHLC
CINMKIWAMPVDFVLEILNVFHPEHIEEFELNTEWNVFNLARFAPCLGQMRNLRKLLLAP
LYKNVFKIANRTGDREDKCVKEFVSIFSKFNCLQHLSMQGVHFLTDHMSQVFRCLMTPLE
SLSITHYQISQSDLDSFSCCQSLFQLKHLEMKGMVLQVLDVMPLRGLLEKVAKTLETLNL
QGCKLKDSQLNALLPSFIRCSQLTKINLYNNDFSMPILKDLLQQTANWNKMNVEQYPAPL
ECYNELGHVSVERFAQLCQELMDTLRAIRQPKSLSFATRICHKCGEPCVYGQGGRLCFCW
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcagactccgtccactctccagaatctgacattgaaggctctgctgagagat
gaggctttggccttgtcctgtctggaggaggtgccttttctgctcttcccagctctgttc
aaggaggcctttgctggcagacttaagaagctcatgaaggcaatcgtggcagcctggact
tttccctgtctccctgtgggggctttgatgaagtcacctaacttggagaccttgcaggct
gtgctagatggaatagacatgcaactgacaagaaaatctcaccccaggggaaaacttcag
gttctggacctgaggaatgtgcaccatgccttctgggacatatgggctggtgcagaggat
ggtagctgttcttcagagtccttgaatgagaagcctacagtagtgaaggtccttcgcaga
tatgcacggaggaagcagctgaaggtggtagcagacctgtgcctcaggccccgccgtgat
gaagcacaagcatacttcttgaagtgggcccagcagagaaaggactccctacatttgtgc
tgtataaacatgaagatctgggctatgcccgtggactttgtcttagagattttgaatgtc
tttcatccagagcacatcgaggaattcgaactgaacactgagtggaatgtgtttaatctg
gcccgttttgctccctgcttagggcagatgagaaatcttcgcaaacttctcctggcaccc
ctctataagaatgtcttcaagattgccaataggacaggagacagagaagataagtgtgtc
aaggagttcgtttctatcttctccaaattcaattgtctccagcatctctccatgcaaggt
gtccactttctcacagaccacatgagtcaggtcttcaggtgcttgatgacacccttggag
tccctctccatcactcactaccaaatttcacagtcagacttggattccttctcttgctgt
cagagtctctttcagctaaaacatctggagatgaaaggcatggtcttacaggttttggat
gtgatgcctctgagaggtctcttagagaaagtggcaaaaactcttgagactctgaatttg
cagggatgtaagctgaaggactctcagctcaatgcactcctaccttccttcatacgatgc
tctcagctcaccaagatcaacttgtacaacaatgacttctccatgcccatcctgaaggac
cttttacagcaaacagccaactggaacaagatgaatgtggaacagtaccctgcccctctg
gagtgttataatgagttgggacatgtctctgtagaaagatttgcccaactttgtcaggaa
ctcatggatacactaagggcaataaggcagcccaagagcctctcttttgctacacgtata
tgccacaaatgtggcgagccctgtgtctatggtcaggggggtagactttgtttttgctgg
cggtga

DBGET integrated database retrieval system