KEGG   Mus musculus (mouse): 100041077Help
Entry
100041077         CDS       T01002                                 

Gene name
Gm13102
Definition
(RefSeq) predicted gene 13102
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4
Motif
Other DBs
NCBI-GeneID: 100041077
NCBI-ProteinID: NP_001078888
MGI: 3703005
Ensembl: ENSMUSG00000073723
Vega: OTTMUSG00000010432
UniProt: Q3ULC4
Position
4; 4 E1
AA seq 500 aa AA seqDB search
MSFKDPPTLQQLARRSLLKDEALTISALPNLPVQLFPPLFKDAFTSRQRKILSLMVATWP
FPVLPVGALCGIDHLETLKAVLDGLDLLMSQKDRPSRWNLQVLDLRDAHQDFWDGWAGLL
HEVCSQDVFGKNQPVGNHPIPGGKQTISIKMNLSLKYCRRHSHCENLNYLYYWAKQRKDV
IQVIFEKLEFTGKHCLRLKLWRLLKLSFVASIQELTIKSIHWDIYNLALIASCLGQMKNL
QKLILMNIRRPSSLTDLQEARIITEIFSEFSKLHKLQHLYVNDVYFLKERLDLMLRCFER
PLETLTITYCKLSESDMRYLSQCPSIHQLKYLDMSYTTFKPSSHRFLGFLGSLLERLTAT
LQTLKLECFHLTDSRIRDLLPGLSQCSQLTEVDFVENKFSMVSLKTLLQHTANLTQLTLE
KYPAPDEVYDDSLCVIPDRFVQLCSELMNTLKGVRQPKQVYFESTIYSPNFEYLVYNLEG
MVSSEPLRRRGRGMVIYISG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaaggacccaccaacactccagcagctggcaagaagaagcctgctaaaagat
gaagccttgactatctctgctctgccgaacctgcctgtgcaactcttcccaccactcttc
aaggatgcattcaccagcagacaacgtaagatcctgagcctgatggtggcaacatggccc
ttcccagtccttcctgtgggagctctgtgtgggattgatcacctggagaccctgaaagct
gtactagatggccttgatttgctgatgtcacaaaaggatcgacctagcaggtggaaccta
caagtgcttgatttgcgagatgcccaccaggacttctgggatggttgggctggactactt
catgaagtctgctctcaagatgtctttggcaagaaccaaccagtgggaaatcatcccatc
ccaggggggaaacagaccataagtataaaaatgaatctttccctcaagtactgccgacga
cactctcattgtgaaaacctaaactatttgtattattgggccaagcagagaaaagatgtg
atacaggtgatctttgagaagctggagtttacaggcaagcactgtctccgactgaagttg
tggcggttgttgaagttgtcttttgtagcctcaatccaggaattgacaataaagtccata
cactgggatatatataaccttgcattgatagcctcttgcctgggccagatgaaaaacctc
cagaaactcattctcatgaacatcaggagaccttcttcccttacggacctacaggaagcc
cgtattattacagagatcttttccgagttctccaaactgcataagctccagcatctctat
gtgaatgatgtctacttcctgaaagaacgcctggacctaatgctcaggtgttttgagcgt
ccattagagacccttactatcacttattgcaagctttcagaatcagacatgaggtatctg
tcccagtgtccaagcatccatcagctcaaatacctggacatgagttacaccacattcaag
ccttcaagtcatcgatttctaggatttctcggaagcctactagaaagactgacagctact
ctgcagacattaaaattggagtgctttcacctcacggactcccgaatccgtgaccttctg
cctgggctgagccagtgttcccagctcactgaagtcgattttgtggagaacaaattttcc
atggtcagcctgaaaacgctgctgcaacatactgccaacctcacacagctgaccctggag
aagtaccctgcacctgatgaagtctatgatgacagtctttgtgttattccagacagattt
gtacaactttgttctgagcttatgaacacactcaagggtgtaaggcagccaaagcaggtc
tactttgagagtacaatatattcacctaattttgaatacctcgtgtataatttggagggc
atggtatcttctgagcctttaagaaggagaggtcgtgggatggtgatatatatcagtggg
tag

DBGET integrated database retrieval system