KEGG   Mus musculus (mouse): 100041273
Entry
100041273         CDS       T01002                                 

Gene name
Ndufb4c, Gm3244
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B4C
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100041273 (Ndufb4c)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100041273 (Ndufb4c)
  09159 Environmental adaptation
   04714 Thermogenesis
    100041273 (Ndufb4c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100041273 (Ndufb4c)
   05012 Parkinson disease
    100041273 (Ndufb4c)
   05014 Amyotrophic lateral sclerosis
    100041273 (Ndufb4c)
   05016 Huntington disease
    100041273 (Ndufb4c)
   05020 Prion disease
    100041273 (Ndufb4c)
   05022 Pathways of neurodegeneration - multiple diseases
    100041273 (Ndufb4c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100041273 (Ndufb4c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100041273 (Ndufb4c)
SSDB
Motif
Pfam: NDUF_B4 Phage_holin_2_4
Other DBs
NCBI-GeneID: 100041273
NCBI-ProteinID: NP_001348976
MGI: 3781422
Ensembl: ENSMUSG00000083380
Structure
PDB: 
6G2J 6G72

Position
15 D3; 15
AA seq 129 aa
MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHI
EDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGK
LDRKFNISY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgggttccaagtataagcctgcgcccctggccactctccccagtaccctcgaccct
gccgagtatgacgtgtctccggagaccagaagggcgcaggtcgagcgcttgagcataagg
gcccggcttaaacgggagtatctgcttcagtacaacgaccccaaacgcgtgtcgcacatc
gaggatcctgccttgattcgctggacctatgcaagatcagcaaatatttatcctaatttc
aggcccactcccaagaactcacttttaggagctgtggcagggtttgggcccctcatcttc
tggtattatgttttcaaaacagacagggacagaaaggaaagacttatccaggaaggaaaa
ctggacagaaaatttaacatctcctactaa

KEGG   Mus musculus (mouse): 100042503
Entry
100042503         CDS       T01002                                 

Gene name
Ndufb4b, Gm3873
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B4B
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100042503 (Ndufb4b)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100042503 (Ndufb4b)
  09159 Environmental adaptation
   04714 Thermogenesis
    100042503 (Ndufb4b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100042503 (Ndufb4b)
   05012 Parkinson disease
    100042503 (Ndufb4b)
   05014 Amyotrophic lateral sclerosis
    100042503 (Ndufb4b)
   05016 Huntington disease
    100042503 (Ndufb4b)
   05020 Prion disease
    100042503 (Ndufb4b)
   05022 Pathways of neurodegeneration - multiple diseases
    100042503 (Ndufb4b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100042503 (Ndufb4b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100042503 (Ndufb4b)
SSDB
Motif
Pfam: NDUF_B4 Phage_holin_2_4
Other DBs
NCBI-GeneID: 100042503
NCBI-ProteinID: XP_001478493
MGI: 3782046
UniProt: Q9CQC7
Structure
PDB: 
6G2J 6G72

Position
19 B; 19
AA seq 129 aa
MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHI
EDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGK
LDRKFNISY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgggttccaagtataagcctgcgcccctggccactctccccagtaccctcgaccct
gccgagtatgacgtgtctccggagaccagaagggcgcaggtcgagcgcttgagcataagg
gcccggcttaaacgggagtatctgcttcagtacaacgaccccaaacgcgtgtcgcacatc
gaggatcctgccttgattcgctggacctatgcaagatcagcaaatatttatcctaatttc
aggcccactcccaagaactcacttttaggagctgtggcagggtttgggcccctcatcttc
tggtattatgttttcaaaacagacagggacagaaaggaaagacttatccaggaaggaaaa
ctggacagaaaatttaacatctcctactaa

KEGG   Mus musculus (mouse): 104130
Entry
104130            CDS       T01002                                 

Gene name
Ndufb11, CI-ESSS, D5Bwg0566e, D5Bwg0577e, NP15.6, Np, Np15, p15.6
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B11
  KO
K11351  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104130 (Ndufb11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    104130 (Ndufb11)
  09159 Environmental adaptation
   04714 Thermogenesis
    104130 (Ndufb11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104130 (Ndufb11)
   05012 Parkinson disease
    104130 (Ndufb11)
   05014 Amyotrophic lateral sclerosis
    104130 (Ndufb11)
   05016 Huntington disease
    104130 (Ndufb11)
   05020 Prion disease
    104130 (Ndufb11)
   05022 Pathways of neurodegeneration - multiple diseases
    104130 (Ndufb11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    104130 (Ndufb11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104130 (Ndufb11)
SSDB
Motif
Pfam: ESSS
Other DBs
NCBI-GeneID: 104130
NCBI-ProteinID: NP_062308
MGI: 1349919
Ensembl: ENSMUSG00000031059
Vega: OTTMUSG00000017084
UniProt: O09111
Structure
PDB: 
6G2J 6G72

Position
X; X A1.3
AA seq 151 aa
MAARLLSLYGRCLSAAGAMRGLPAARVRWESSRAVIAPSGVEKKRQREPTMQWQEDPEPE
DENVYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYVPDYRMQEWARREA
ERLVKYREVNGLPIMESNYFDPSKIQLPEDD
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcggcccgactgttaagcttgtatggtcgctgcctgtcagcagcgggggcgatgaga
gggctcccggctgctcgcgttcgctgggagtcctccagggctgtaatcgccccatccggt
gtggagaaaaagcggcaacgagaaccgaccatgcagtggcaggaggacccagaacccgag
gacgaaaacgtctacgcgaagaaccctgactttcatggttatgatagtgaccctgtggtg
gacgtctggaatatgcgagctgtcttcttctttggtttttccatcgtcctggtctttggg
accaccttcgtggcttatgtgcctgattacaggatgcaagagtgggcccgccgggaagct
gagagacttgtgaaataccgagaagtcaatggccttcccatcatggaatccaactacttc
gatcccagcaagatccagttaccagaagatgactga

KEGG   Mus musculus (mouse): 17716
Entry
17716             CDS       T01002                                 

Gene name
ND1
Definition
(RefSeq) NADH dehydrogenase subunit 1
  KO
K03878  NADH-ubiquinone oxidoreductase chain 1 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17716 (ND1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17716 (ND1)
  09159 Environmental adaptation
   04714 Thermogenesis
    17716 (ND1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17716 (ND1)
   05012 Parkinson disease
    17716 (ND1)
   05014 Amyotrophic lateral sclerosis
    17716 (ND1)
   05016 Huntington disease
    17716 (ND1)
   05020 Prion disease
    17716 (ND1)
   05022 Pathways of neurodegeneration - multiple diseases
    17716 (ND1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17716 (ND1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17716 (ND1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17716 (ND1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17716 (ND1)
SSDB
Motif
Pfam: NADHdh
Other DBs
NCBI-GeneID: 17716
NCBI-ProteinID: NP_904328
MGI: 101787
UniProt: P03888 Q4JFN6
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 318 aa
MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEP
MRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSG
WASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWP
MAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTI
IFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLAL
CMWHISLPIFTAGVPPYM
NT seq 957 nt   +upstreamnt  +downstreamnt
gtgttctttattaatatcctaacactcctcgtccccattctaatcgccatagccttccta
acattagtagaacgcaaaatcttagggtacatacaactacgaaaaggccctaacattgtt
ggtccatacggcattttacaaccatttgcagacgccataaaattatttataaaagaacca
atacgccctttaacaacctctatatccttatttattattgcacctaccctatcactcaca
ctagcattaagtctatgagttcccctaccaataccacacccattaattaatttaaaccta
gggattttatttattttagcaacatctagcctatcagtttactccattctatgatcagga
tgagcctcaaactccaaatactcactattcggagctttacgagccgtagcccaaacaatt
tcatatgaagtaaccatagctattatccttttatcagttctattaataaatggatcctac
tctctacaaacacttattacaacccaagaacacatatgattacttctgccagcctgaccc
atagccataatatgatttatctcaaccctagcagaaacaaaccgggcccccttcgacctg
acagaaggagaatcagaattagtatcagggtttaacgtagaatacgcagccggcccattc
gcgttattctttatagcagagtacactaacattattctaataaacgccctaacaactatt
atcttcctaggacccctatactatatcaatttaccagaactctactcaactaacttcata
atagaagctctactactatcatcaacattcctatggatccgagcatcttatccacgcttc
cgttacgatcaacttatacatcttctatgaaaaaactttctacccctaacactagcatta
tgtatgtgacatatttctttaccaatttttacagcgggagtaccaccatacatatag

KEGG   Mus musculus (mouse): 17717
Entry
17717             CDS       T01002                                 

Gene name
ND2
Definition
(RefSeq) NADH dehydrogenase subunit 2
  KO
K03879  NADH-ubiquinone oxidoreductase chain 2 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17717 (ND2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17717 (ND2)
  09159 Environmental adaptation
   04714 Thermogenesis
    17717 (ND2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17717 (ND2)
   05012 Parkinson disease
    17717 (ND2)
   05014 Amyotrophic lateral sclerosis
    17717 (ND2)
   05016 Huntington disease
    17717 (ND2)
   05020 Prion disease
    17717 (ND2)
   05022 Pathways of neurodegeneration - multiple diseases
    17717 (ND2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17717 (ND2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17717 (ND2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17717 (ND2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17717 (ND2)
SSDB
Motif
Pfam: Proton_antipo_M NADH_dehy_S2_C DUF2107
Other DBs
NCBI-GeneID: 17717
NCBI-ProteinID: NP_904329
MGI: 102500
UniProt: P03893 Q9MD59
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 345 aa
MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLINKKNPRSTEAATKYF
VTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQ
GIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAITSIFMGAWGGLNQTQMRKIMA
YSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLNNSMTINSISLLWNKTPAM
LTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYST
SLTMFPTNNNSKMMTHQTKTKPNLMFSTLAIMSTMTLPLAPQLIT
NT seq 1038 nt   +upstreamnt  +downstreamnt
ataaatcctatcacccttgccatcatctacttcacaatcttcttaggtcctgtaatcaca
atatccagcaccaacctaatactaatatgagtaggcctggaattcagcctactagcaatt
atccccatactaatcaacaaaaaaaacccacgatcaactgaagcagcaacaaaatacttc
gtcacacaagcaacagcctcaataattatcctcctggccatcgtactcaactataaacaa
ctaggaacatgaatatttcaacaacaaacaaacggtcttatccttaacataacattaata
gccctatccataaaactaggcctcgccccattccacttctgattaccagaagtaactcaa
gggatcccactgcacataggacttattcttcttacatgacaaaaaattgctcccctatca
attttaattcaaatttacccgctactcaactctactatcattttaatactagcaattact
tctattttcataggggcatgaggaggacttaaccaaacacaaatacgaaaaattatagcc
tattcatcaattgcccacataggatgaatattagcaattcttccttacaacccatccctc
actctactcaacctcataatctatattattcttacagcccctatattcatagcacttata
ctaaataactctataaccatcaactcaatctcacttctatgaaataaaactccagcaata
ctaactataatctcactgatattactatccctaggaggccttccaccactaacaggattc
ttaccaaaatgaattatcatcacagaacttataaaaaacaactgtctaattatagcaaca
ctcatagcaataatagctctactaaacctattcttttatactcgcctaatttattccact
tcactaacaatatttccaaccaacaataactcaaaaataataactcaccaaacaaaaact
aaacccaacctaatattttccaccctagctatcataagcacaataaccctacccctagcc
ccccaactaattacctag

KEGG   Mus musculus (mouse): 17718
Entry
17718             CDS       T01002                                 

Gene name
ND3
Definition
(RefSeq) NADH dehydrogenase subunit 3
  KO
K03880  NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17718 (ND3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17718 (ND3)
  09159 Environmental adaptation
   04714 Thermogenesis
    17718 (ND3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17718 (ND3)
   05012 Parkinson disease
    17718 (ND3)
   05014 Amyotrophic lateral sclerosis
    17718 (ND3)
   05016 Huntington disease
    17718 (ND3)
   05020 Prion disease
    17718 (ND3)
   05022 Pathways of neurodegeneration - multiple diseases
    17718 (ND3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17718 (ND3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17718 (ND3)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17718 (ND3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17718 (ND3)
SSDB
Motif
Pfam: Oxidored_q4
Other DBs
NCBI-GeneID: 17718
NCBI-ProteinID: NP_904335
MGI: 102499
UniProt: P03899 Q7GIP5
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 115 aa
MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAI
TFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSLGLAYEWTQKGLEWTE
NT seq 348 nt   +upstreamnt  +downstreamnt
attaacctgtacactgttatcttcattaatattttattatccctaacgctaattctagtt
gcattctgactcccccaaataaatctgtactcagaaaaagcaaatccatatgaatgcgga
ttcgaccctacaagctctgcacgtctaccattctcaataaaatttttcttggtagcaatt
acatttctattatttgacctagaaattgctcttctacttccactaccatgagcaattcaa
acaattaaaacctctactataataattatagcctttattctagtcacaattctatctcta
ggcctagcatatgaatgaacacaaaaaggattagaatgaacagagtaa

KEGG   Mus musculus (mouse): 17719
Entry
17719             CDS       T01002                                 

Gene name
ND4
Definition
(RefSeq) NADH dehydrogenase subunit 4
  KO
K03881  NADH-ubiquinone oxidoreductase chain 4 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17719 (ND4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17719 (ND4)
  09159 Environmental adaptation
   04714 Thermogenesis
    17719 (ND4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17719 (ND4)
   05012 Parkinson disease
    17719 (ND4)
   05014 Amyotrophic lateral sclerosis
    17719 (ND4)
   05016 Huntington disease
    17719 (ND4)
   05020 Prion disease
    17719 (ND4)
   05022 Pathways of neurodegeneration - multiple diseases
    17719 (ND4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17719 (ND4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17719 (ND4)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17719 (ND4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17719 (ND4)
SSDB
Motif
Pfam: Proton_antipo_M Oxidored_q5_N
Other DBs
NCBI-GeneID: 17719
NCBI-ProteinID: NP_904337
MGI: 102498
UniProt: P03911 Q7JCY6
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 459 aa
MLKIILPSLMLLPLTWLSSPKKTWTNVTSYSFLISLTSLTLLWQTDENYKNFSNMFSSDP
LSTPLIILTAWLLPLMLMASQNHLKKDNNVLQKLYISMLISLQILLIMTFSATELIMFYI
LFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALILIQNHVGTLNLMILS
FTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGS
YGMIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIAS
IMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSRTMIMARGLQMVFPLMATWWL
MASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLT
NHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
NT seq 1378 nt   +upstreamnt  +downstreamnt
atgctaaaaattattcttccctcactaatgctactaccactaacctgactatcaagccct
aaaaaaacctgaacaaacgtaacctcatatagttttctaattagtttaaccagcctaaca
cttctatgacaaaccgacgaaaattataaaaacttttcaaatatattctcctcagacccc
ctatccacaccattaattattttaacagcctgattactgccactaatattaatagctagc
caaaaccacctaaaaaaagataataacgtactacaaaaactctacatctcaatactaatc
agcttacaaattctcctaatcataaccttttcagcaactgaactaattatattttatatt
ttatttgaagcaaccttaatcccaacacttattattattacccgatgagggaaccaaact
gaacgcctaaacgcagggatttatttcctattttataccctaatcggttctattccactg
ctaattgccctcatcttaatccaaaaccatgtaggaaccctaaacctcataattttatca
ttcacaacacacaccttagacgcttcatgatctaacaacttactatggttggcatgcata
atagcatttcttattaaaataccattatatggagttcacctatgactaccaaaagcccat
gttgaagctccaattgctgggtcaataattctagcagctattcttctaaaattaggtagt
tacggaataattcgcatctccattattctagacccactaacaaaatatatagcatacccc
ttcatccttctctccctatgaggaataattataactagctcaatctgcttacgccaaaca
gatttaaaatcactaatcgcctactcctcagttagccacatagcacttgttattgcatca
atcataatccaaactccatgaagcttcataggagcaacaatactaataatcgcacatggc
ctcacatcatcactcctattctgcctagcaaactccaactacgaacggatccacagccgt
actataatcatggcccgaggacttcaaatggtcttcccacttatagccacatgatgactg
atagcaagtctagctaatctagctctacccccttcaatcaatctaataggagaattattc
attaccatatcattattttcttgatcaaactttaccattattcttataggaattaacatt
attattacaggtatatactcaatatacataattattaccacccaacgcggcaaactaacc
aaccatataattaacctccaaccctcacacacacgagaactaacactaatagcccttcac
ataattccacttattcttctaactaccagtccaaaactaattacaggcctgacaatat

KEGG   Mus musculus (mouse): 17720
Entry
17720             CDS       T01002                                 

Gene name
ND4L
Definition
(RefSeq) NADH dehydrogenase subunit 4L
  KO
K03882  NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17720 (ND4L)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17720 (ND4L)
  09159 Environmental adaptation
   04714 Thermogenesis
    17720 (ND4L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17720 (ND4L)
   05012 Parkinson disease
    17720 (ND4L)
   05014 Amyotrophic lateral sclerosis
    17720 (ND4L)
   05016 Huntington disease
    17720 (ND4L)
   05020 Prion disease
    17720 (ND4L)
   05022 Pathways of neurodegeneration - multiple diseases
    17720 (ND4L)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17720 (ND4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17720 (ND4L)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17720 (ND4L)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17720 (ND4L)
SSDB
Motif
Pfam: Oxidored_q2 DUF5368
Other DBs
NCBI-GeneID: 17720
NCBI-ProteinID: NP_904336
MGI: 102497
UniProt: P03903 Q9MD77
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 98 aa
MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTSVTSLNSNSMSSMPIP
ITILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC
NT seq 297 nt   +upstreamnt  +downstreamnt
atgccatctaccttcttcaacctcaccatagccttctcactatcacttctagggacactt
atatttcgctctcacctaatatccacattactatgcctggaaggcatagtattatcctta
tttattataacttcagtaacttccctaaactccaactccataagctccataccaatcccc
atcaccatcttagttttcgcagcctgcgaagcagctgtaggactagccctactagtaaaa
gtttcaaacacgtacggaacagattacgtccaaaatctcaacctactacaatgctaa

KEGG   Mus musculus (mouse): 17721
Entry
17721             CDS       T01002                                 

Gene name
ND5
Definition
(RefSeq) NADH dehydrogenase subunit 5
  KO
K03883  NADH-ubiquinone oxidoreductase chain 5 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17721 (ND5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17721 (ND5)
  09159 Environmental adaptation
   04714 Thermogenesis
    17721 (ND5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17721 (ND5)
   05012 Parkinson disease
    17721 (ND5)
   05014 Amyotrophic lateral sclerosis
    17721 (ND5)
   05016 Huntington disease
    17721 (ND5)
   05020 Prion disease
    17721 (ND5)
   05022 Pathways of neurodegeneration - multiple diseases
    17721 (ND5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17721 (ND5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17721 (ND5)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17721 (ND5)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17721 (ND5)
SSDB
Motif
Pfam: Proton_antipo_M NADH5_C Proton_antipo_N
Other DBs
NCBI-GeneID: 17721
NCBI-ProteinID: NP_904338
MGI: 102496
UniProt: P03921 Q9MD82
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 607 aa
MNIFTTSILLIFILLLSPILISMSNLIKHINFPLYTTTSIKFSFIISLLPLLMFFHNNME
YMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQFSSWYMHSDPNINRFIKY
LTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDI
GFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAMEGP
TPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLCLGALTTLFTAICALTQNDIKK
IIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMG
NITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALLITLIATSMTA
MYSMRIIYFVTMTKPRFPPLISINENDPDLMNPIKRLAFGSIFAGFVISYNIPPTSIPVL
TMPWFLKTTALIISVLGFLIALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMK
SLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIII
LYSINLE
NT seq 1824 nt   +upstreamnt  +downstreamnt
atcaatattttcacaacctcaatcttattaatcttcattcttctactatccccaatccta
atttcaatatcaaacctaattaaacacatcaacttcccactgtacaccaccacatcaatc
aaattctccttcattattagcctcttacccctattaatatttttccacaataatatagaa
tatataattacaacctggcactgagtcaccataaattcaatagaacttaaaataagcttc
aaaactgactttttctctatcctgtttacatctgtagccctttttgtcacatgatcaatt
atacaattctcttcatgatatatacactcagacccaaacatcaatcgattcattaaatat
cttacactattcctgattaccatgcttatcctcacctcagccaacaacatatttcaactt
ttcattggctgagaaggggtgggaattatatctttcctactaattggatgatggtacgga
cgaacagacgcaaatactgcagccctacaagcaatcctctataaccgcatcggagacatc
ggattcattttagctatagtttgattttccctaaacataaactcatgagaacttcaacag
attatattctccaacaacaacgacaatctaattccacttataggcctattaatcgcagct
acaggaaaatcagcacaatttggcctccacccatgactaccatcagcaatagaaggccct
acaccagtttcagcactactacactcaagtacaatagtagttgcaggaattttcctactg
gtccgattccaccccctcacgactaataataactttattttaacaactatactttgcctc
ggagccctaaccacattatttacagctatttgtgctctcacccaaaacgacatcaaaaaa
atcattgccttctctacatcaagccaactaggcctgataatagtgacgctaggaataaac
caaccacacctagcattcctacacatctgtacccacgcattcttcaaagctatactcttt
atatgctctggctcaatcattcatagcctggcagacgaacaagacatccgaaaaatagga
aacatcacaaaaatcataccattcacatcatcatgcctagtaatcggaagcctcgccctc
acaggaataccattcctaacagggttctactcaaaagacctaattattgaagcaattaat
acctgcaacaccaacgcctgagccctactaattacactaatcgccacttctataacagct
atgtacagcatacgaatcatttacttcgtaacaataacaaaaccgcgttttcccccccta
atctccattaacgaaaatgacccagacctcataaacccaatcaaacgcctagcattcgga
agcatctttgcaggatttgtcatctcatataatattccaccaaccagcattccagtcctc
acaataccatgatttttaaaaaccacagccctaattatttcagtattaggattcctaatc
gcactagaactaaacaacctaaccataaaactatcaataaataaagcaaatccatattca
tccttctcaactttactggggtttttcccatctattattcaccgcattacacccataaaa
tctctcaacctaagcctaaaaacatccctaactctcctagacttgatctggttagaaaaa
accatcccaaaatccacctcaactcttcacacaaacataaccactttaacaaccaaccaa
aaaggcttaattaaattgtactttatatcattcctaattaacatcatcttaattattatc
ttatactcaattaatctcgagtaa

KEGG   Mus musculus (mouse): 17722
Entry
17722             CDS       T01002                                 

Gene name
ND6
Definition
(RefSeq) NADH dehydrogenase subunit 6
  KO
K03884  NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17722 (ND6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17722 (ND6)
  09159 Environmental adaptation
   04714 Thermogenesis
    17722 (ND6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17722 (ND6)
   05012 Parkinson disease
    17722 (ND6)
   05014 Amyotrophic lateral sclerosis
    17722 (ND6)
   05016 Huntington disease
    17722 (ND6)
   05020 Prion disease
    17722 (ND6)
   05022 Pathways of neurodegeneration - multiple diseases
    17722 (ND6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17722 (ND6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    17722 (ND6)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17722 (ND6)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    17722 (ND6)
SSDB
Motif
Pfam: Oxidored_q3
Other DBs
NCBI-GeneID: 17722
NCBI-ProteinID: NP_904339
MGI: 102495
UniProt: P03925 Q7JCY4
Structure
PDB: 
6G2J 6G72

Position
MT
AA seq 172 aa
MNNYIFVLSSLFLVGCLGLALKPSPIYGGLGLIVSGFVGCLMVLGFGGSFLGLMVFLIYL
GGMLVVFGYTTAMATEEYPETWGSNWLILGFLVLGVIMEVFLICVLNYYDEVGVINLDGL
GDWLMYEVDDVGVMLEGGIGVAAMYSCATWMMVVAGWSLFAGIFIIIEITRD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaataattatatttttgttttaagttcattatttttggttggttgtcttgggttagca
ttaaagccttcacctatttatggaggtttaggtttaattgttagtgggtttgttggttgt
ttaatggttttagggtttggtggatcgtttttaggtttaatagtttttttaatttattta
ggggggatgttggttgtgtttggatatacgactgctatagctactgaggaatatccagag
acttggggatctaactgattaattttgggttttttagtattgggggtgattatagaggtt
tttttaatttgtgtgcttaattattatgatgaagttggagtaattaatcttgatggtttg
ggagattggttgatgtatgaggttgatgatgttggagttatgttggaaggagggattggg
gtagcggcaatatatagttgtgctacttgaatgatggtagtagctgggtgatctttgttt
gcgggtatttttattattatcgagattactcgagattaa

KEGG   Mus musculus (mouse): 17991
Entry
17991             CDS       T01002                                 

Gene name
Ndufa2, AV000592, B8, C1-B8, CI-B8
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17991 (Ndufa2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17991 (Ndufa2)
  09159 Environmental adaptation
   04714 Thermogenesis
    17991 (Ndufa2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17991 (Ndufa2)
   05012 Parkinson disease
    17991 (Ndufa2)
   05014 Amyotrophic lateral sclerosis
    17991 (Ndufa2)
   05016 Huntington disease
    17991 (Ndufa2)
   05020 Prion disease
    17991 (Ndufa2)
   05022 Pathways of neurodegeneration - multiple diseases
    17991 (Ndufa2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17991 (Ndufa2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17991 (Ndufa2)
SSDB
Motif
Pfam: L51_S25_CI-B8
Other DBs
NCBI-GeneID: 17991
NCBI-ProteinID: NP_035015
MGI: 1343103
Ensembl: ENSMUSG00000014294
Vega: OTTMUSG00000042397
UniProt: Q9CQ75
Structure
PDB: 
6G2J 6G72

Position
18; 18 B2
AA seq 99 aa
MAAAAASRAVGAKLGLREIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSE
VQPKLWARYAFGQEKTVSLNNLSADEVTRAMQNVLSGKA
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcggctgccgctgctagccgagcggtcggcgcaaagctggggttgcgtgagattcgc
gttcacttatgccagcgttccccaggcagccagggtgtgagggatttcatcgtgcaacgg
tacgtggagctgaagaaggcgcaccccaacctgcccattctgatccgcgaatgctcggag
gtgcagcccaagctttgggcccgctatgcttttggccaagagaagacggtgtctctgaac
aatctgagtgctgatgaggtaaccagagccatgcagaatgtgctaagcggcaaagcctga

KEGG   Mus musculus (mouse): 17992
Entry
17992             CDS       T01002                                 

Gene name
Ndufa4, ML, MLRQ
Definition
(RefSeq) Ndufa4, mitochondrial complex associated
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17992 (Ndufa4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17992 (Ndufa4)
  09159 Environmental adaptation
   04714 Thermogenesis
    17992 (Ndufa4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17992 (Ndufa4)
   05012 Parkinson disease
    17992 (Ndufa4)
   05014 Amyotrophic lateral sclerosis
    17992 (Ndufa4)
   05016 Huntington disease
    17992 (Ndufa4)
   05020 Prion disease
    17992 (Ndufa4)
   05022 Pathways of neurodegeneration - multiple diseases
    17992 (Ndufa4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17992 (Ndufa4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17992 (Ndufa4)
SSDB
Motif
Pfam: B12D
Other DBs
NCBI-GeneID: 17992
NCBI-ProteinID: NP_035016
MGI: 107686
Ensembl: ENSMUSG00000029632
Vega: OTTMUSG00000057021
UniProt: Q62425
Position
6; 6 A1
AA seq 82 aa
MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPN
EQYKFYSVNVDYSKLKKEGPDF
NT seq 249 nt   +upstreamnt  +downstreamnt
atgctccgccagatcctcgggcaagccaagaagcatcccagcttgattcctctcttcgta
tttattggagcagggggtactggagcagcactgtatgtgatgcgcttggcactgtttaat
ccagatgtcagctgggacagaaagaacaacccagagccatggaacaaactgggtcccaat
gaacaatataagttctactctgtgaatgtggactacagcaaactgaagaaagaaggccca
gacttctaa

KEGG   Mus musculus (mouse): 17993
Entry
17993             CDS       T01002                                 

Gene name
Ndufs4, 6720411N02Rik, C1-18k
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S4
  KO
K03937  NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17993 (Ndufs4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17993 (Ndufs4)
  09159 Environmental adaptation
   04714 Thermogenesis
    17993 (Ndufs4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17993 (Ndufs4)
   05012 Parkinson disease
    17993 (Ndufs4)
   05014 Amyotrophic lateral sclerosis
    17993 (Ndufs4)
   05016 Huntington disease
    17993 (Ndufs4)
   05020 Prion disease
    17993 (Ndufs4)
   05022 Pathways of neurodegeneration - multiple diseases
    17993 (Ndufs4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17993 (Ndufs4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17993 (Ndufs4)
SSDB
Motif
Pfam: ETC_C1_NDUFA4
Other DBs
NCBI-GeneID: 17993
NCBI-ProteinID: NP_035017
MGI: 1343135
Ensembl: ENSMUSG00000021764
UniProt: Q9CXZ1 E9QPX3
Structure
PDB: 
6G2J 6G72

Position
13; 13 D2.2
AA seq 175 aa
MAAVSMSVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLD
ITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP
LSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK
NT seq 528 nt   +upstreamnt  +downstreamnt
atggcggcggtctcaatgtcagtgtcgctgagacaggcgatgttggggcgaagggcaatg
gctacagctgccgtttccgtctgtagagttccatccaggttgttgagcacatccacttgg
aagctggcagacaaccagactcgggacacacagcttataacagttgatgagaaactggat
atcacaactttaactggtgttccagaagagcacatcaaaaccagaaaggtcagaatcttt
gttcctgctcgcaataacatgcagtctggagtaaataacacaaagaaatggaagatggag
tttgataccagagagagatgggaaaatcctttgatgggttgggcatcaaccgctgacccc
ctctccaacatggttctgaccttcagtgccaaagaagatgcaattgcctttgcagaaaaa
aacggatggagctatgatgtggaagagaagaaggttccgaaacccaagtccaagtcttat
ggtgcaaacttttcttggaacaaaagaacaagagtgtctacaaaatag

KEGG   Mus musculus (mouse): 17995
Entry
17995             CDS       T01002                                 

Gene name
Ndufv1, CI-51kD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V1
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    17995 (Ndufv1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    17995 (Ndufv1)
  09159 Environmental adaptation
   04714 Thermogenesis
    17995 (Ndufv1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    17995 (Ndufv1)
   05012 Parkinson disease
    17995 (Ndufv1)
   05014 Amyotrophic lateral sclerosis
    17995 (Ndufv1)
   05016 Huntington disease
    17995 (Ndufv1)
   05020 Prion disease
    17995 (Ndufv1)
   05022 Pathways of neurodegeneration - multiple diseases
    17995 (Ndufv1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    17995 (Ndufv1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    17995 (Ndufv1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     17995 (Ndufv1)
SSDB
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Other DBs
NCBI-GeneID: 17995
NCBI-ProteinID: NP_598427
MGI: 107851
Ensembl: ENSMUSG00000037916
Vega: OTTMUSG00000034058
UniProt: Q91YT0
Structure
PDB: 
6G2J 6G72

Position
19 3.72 cM; 19 A
AA seq 464 aa
MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgctagcggcacggcattttctcggcgggttggttcccgtgcgggtatctgtgcgtttc
agcagcggcacgacagcacccaagaaaacctcatttggctcactgaaggatgaagaccgg
atctttaccaacctgtatgggcgccatgactggaggctgaaaggtgccctgagacggggt
gactggtacaagacaaaggagatcctgctgaaggggcctgactggatcttgggtgagatg
aagacatcaggtttacggggccgtggtggtgctggcttccccactggcctcaagtggagc
ttcatgaataagccctcagatggcaggcccaagtatctggtggtgaatgctgacgaggga
gagccaggcacctgtaaggaccgagagatcatgcgtcatgaccctcacaagctggtggaa
ggctgccttgtgggaggccgggccatgggagcccgggccgcctatatctacatccgaggg
gaattctacaacgaggcctccaatttgcaggtagctatccgagaggcctatgaagcaggt
ctgattggcaagaatgcttgtggctccgactatgattttgatgtgtttgtggtgcgtggg
gctggggcctacatctgtggagaagagacggcacttattgaatccattgaaggcaagcag
ggaaagccacgcctgaagccgccctttccagcagatgtgggagtgtttggatgccccaca
actgtggccaatgtggagacagtggctgtgtcccccaccatttgccgtcgtgggggcacc
tggtttgctggctttggccgagaacgcaattcaggtaccaaattgtttaacatctctggc
catgtcaaccacccctgcactgtggaggaagagatgtctgtgccactgaaagagctgatt
gagaaacatgctggtggtgtcacaggtggctgggacaacctccttgctgtgattcctggt
ggctcatctactccactgattcccaaatctgtgtgtgagaccgtgctaatggacttcgat
gcactggtgcaggctcagacaggcctgggcacggctgcagttattgttatggatcgctcg
acagacattgtgaaagccatcgctcgtctcattgagttctacaagcatgagagctgtggc
cagtgtaccccgtgccgtgagggcgttgactggatgaacaaggtgatggcccgatttgtg
aagggagatgcccggccagctgagattgactccctgtgggagatcagcaagcagatagaa
ggccacaccatttgtgctctgggtgatggggctgcctggccagtacagggtctgatccga
catttcaggccagagcttgaggatcggatgcaacgatttgcccagcagcaccgggcctgg
caggcagcctcgtga

KEGG   Mus musculus (mouse): 225887
Entry
225887            CDS       T01002                                 

Gene name
Ndufs8, BC021616, CI-23kD, TYKY
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S8
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    225887 (Ndufs8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    225887 (Ndufs8)
  09159 Environmental adaptation
   04714 Thermogenesis
    225887 (Ndufs8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    225887 (Ndufs8)
   05012 Parkinson disease
    225887 (Ndufs8)
   05014 Amyotrophic lateral sclerosis
    225887 (Ndufs8)
   05016 Huntington disease
    225887 (Ndufs8)
   05020 Prion disease
    225887 (Ndufs8)
   05022 Pathways of neurodegeneration - multiple diseases
    225887 (Ndufs8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    225887 (Ndufs8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    225887 (Ndufs8)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     225887 (Ndufs8)
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_9 Fer4_10 Fer4_8 Fer4_6 Fer4_2 Fer4_4 Fer4_17 c-SKI_SMAD_bind Fer4_18 Fer4_3 Fer4_13
Other DBs
NCBI-GeneID: 225887
NCBI-ProteinID: NP_001258372
MGI: 2385079
Ensembl: ENSMUSG00000059734
UniProt: Q8K3J1 Q5M9P5 Q3UY05
Structure
PDB: 
6G2J 6G72

Position
19; 19 A
AA seq 212 aa
MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARI
LMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCE
AICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH
EELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgtatcgcctgagctcatcaatgctgccacgggccttggcccaggccatgcgcacagga
catcttaatggacaaagccttcatagcagcgcagtggcggcaacgtacaagtatgtgaat
aagaaggaacaggagtctgaggtggacatgaagtccgcaactgacaatgcagctcggatt
ctgatgtggacagaactcatccgaggactgggcatgaccctaagttacctctttcgagag
cctgccaccatcaactacccctttgagaagggcccactgagtccgcgcttccgtggggag
catgcactgcgccgctacccatctggagaggagcgttgcattgcctgcaaactctgtgag
gccatctgtcctgcacaggccatcaccattgaggctgagccaagagccgatggcagccgc
cgaacgacacgctatgacatcgacatgaccaagtgtatctactgtggtttctgccaggaa
gcctgccctgttgatgccattgtggagggccccaacttcgagttctccaccgagacacac
gaggagttgctgtacaacaaggagaagctactcaacaatggagacaagtgggaggccgag
atcgctgccaacatccaggctgactacctgtaccggtga

KEGG   Mus musculus (mouse): 226646
Entry
226646            CDS       T01002                                 

Gene name
Ndufs2, CI-49kD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S2
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    226646 (Ndufs2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    226646 (Ndufs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    226646 (Ndufs2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    226646 (Ndufs2)
   05012 Parkinson disease
    226646 (Ndufs2)
   05014 Amyotrophic lateral sclerosis
    226646 (Ndufs2)
   05016 Huntington disease
    226646 (Ndufs2)
   05020 Prion disease
    226646 (Ndufs2)
   05022 Pathways of neurodegeneration - multiple diseases
    226646 (Ndufs2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    226646 (Ndufs2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    226646 (Ndufs2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     226646 (Ndufs2)
SSDB
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Other DBs
NCBI-GeneID: 226646
NCBI-ProteinID: NP_694704
MGI: 2385112
Ensembl: ENSMUSG00000013593
Vega: OTTMUSG00000021571
UniProt: Q91WD5
Structure
PDB: 
6G2J 6G72

Position
1; 1 H3
AA seq 463 aa
MAALRALRCLRGVGAPVLRPGSGIRLPSQPSRGARQWQPDIEWAEQFSGAVMYPSKETAH
WKPPPWNDVDILKEKAVTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRI
LNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
LDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggccctgagggcgctgcgctgcctccgtggggtcggagccccggtgctgcggccc
gggtctgggatccgcttgccaagtcagcccagcagaggtgctcggcagtggcagccagat
attgaatgggcagagcagttttcgggagctgtcatgtacccctccaaggaaacagcccac
tggaaacctcctccttggaatgatgtggacattttgaaggaaaaagcggtgaccaacatg
accctgaactttgggccccagcacccagcagcccacggagtcctgagactcgtgctggaa
ctgagtggagagatggtgcggaaatgtgaccctcacatcgggctcctgcaccgaggcacg
gagaagctcattgagtacaagacctatctgcaggcccttccatactttgaccggttggac
tatgtgtccatgatgtgtaatgaacaggcctattcgatagctgtggagaagttgctaaac
atccaacctcctcctcgggcacagtggatccgagtgctctttggagagatcacacggatt
ttaaaccatatcatggctgtcaccacacatgccctggacatcggtgccatgactcctttc
ttctggatgtttgaagaaagagagaagatgttcgagttctatgagcgggtgtctggggcc
cggatgcacgcggcgtatatccgacctggaggagtgcaccaggacctacctcttgggctt
ctggatgacatttatgagttttccaagaacttctctcttcggattgatgaggtggaggag
atgctgaccaacaatagaatctggcgaaataggacagtcgacattggggttgtaacagcg
gaagacgcacttaactatggattcagtggggtgatgctccgaggctcaggcatccagtgg
gacttgcggaagacccagccctatgacgtttacgaccaggtggagtttgatgttcctatc
ggttctcgaggggactgctacgataggtacctgtgtcgtgtggaggagatgcgccagtcc
ctgcgaatcattgagcagtgtctgaacaagatgcctcccggggagatcaaggttgatgac
gccaaagtgtccccaccgaagcgagcagagatgaagacgtccatggagtcactaattcat
cactttaagctgtatacagagggctaccaagttcctccaggagccacatatactgccatt
gaagctcctaagggagagtttggggtatacttggtatccgatggcagcagccgcccttat
cggtgtaagatcaaggctcccggttttgcccacctggctggtttggacaagatgtctaag
ggacacatgttggcagatgtcgtggccatcataggtacccaggatattgtgttcggagaa
atagaccgatga

KEGG   Mus musculus (mouse): 227197
Entry
227197            CDS       T01002                                 

Gene name
Ndufs1, 5830412M15Rik, 9930026A05Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S1
  KO
K03934  NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    227197 (Ndufs1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    227197 (Ndufs1)
  09159 Environmental adaptation
   04714 Thermogenesis
    227197 (Ndufs1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    227197 (Ndufs1)
   05012 Parkinson disease
    227197 (Ndufs1)
   05014 Amyotrophic lateral sclerosis
    227197 (Ndufs1)
   05016 Huntington disease
    227197 (Ndufs1)
   05020 Prion disease
    227197 (Ndufs1)
   05022 Pathways of neurodegeneration - multiple diseases
    227197 (Ndufs1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    227197 (Ndufs1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    227197 (Ndufs1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     227197 (Ndufs1)
SSDB
Motif
Pfam: Molybdopterin Fer2_4 NADH_dhqG_C NADH-G_4Fe-4S_3 Fer2
Other DBs
NCBI-GeneID: 227197
NCBI-ProteinID: NP_001153510
MGI: 2443241
Ensembl: ENSMUSG00000025968
Vega: OTTMUSG00000002613
UniProt: Q91VD9
Structure
PDB: 
6G2J 6G72

Position
1; 1 C2
AA seq 727 aa
MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAAIAGGLVDAEALVALKDLLNK
VDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGRHSFCEVLKDAKKPMVVLGSSA
LQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKN
PPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPMADVILPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIE
ETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSIC
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgttaaggatacctataaaaagggccttgataggcctttctaattctcctaaaggatat
gttcgcacaactggcacagcagcaagtaacttgattgaagtatttgttgatggtcagtct
gtcatggtggaaccaggaaccactgttctgcaggcttgcgagaaggtcggcatgcaaatc
cctcgattctgttaccatgaaaggttgtctgttgctggaaattgcaggatgtgcctggta
gagattgagaaagctccaaaggttgtcgctgcttgtgctatgcctgtaatgaagggctgg
aatatcttgacaaactcggaaaaatctaagaaagccagagaaggtgtgatggagttctta
ttagcaaatcacccattggattgtcctatttgtgaccagggaggtgaatgtgatctgcag
gaccagtccatgatgtttggaagtgataggagccgatttctagaggggaagcgtgctgtg
gaggacaagaacattgggcccctagtaaagaccatcatgactagatgcatccagtgtacc
cggtgcatcaggtttgcaagtgagattgcaggagtagatgatttgggaacaacaggaaga
ggaaatgacatgcaagttggcacatacattgaaaaaatgtttatgtctgaactgtctggg
aatgtcattgatatctgccctgtaggggccctaacctctaagccttatgcctttactgcc
cggccttgggaaacaagaaagacagagtccattgatgtaatggatgcagtgggaagtaac
attgtggttagcacaagaactggagaggtaatgaggattttgccaagaatgcatgaagat
attaatgaagaatggatctctgataaaaccaggtttgcttatgatggactaaaacgtcaa
agacttactgaaccaatggtcagaaacgaaaaagggcttttaacttatacctcctgggaa
gatgcactctctcgtgtagctggaatgttacagaattttgaaggcaatgctgtggcagcg
attgcaggaggcttggtggatgctgaagccttagtagctctgaaagacttgcttaataaa
gttgactctgacaacttatgcactgaagagatcttccccactgaaggagctggtacagac
ttacgttccaattatcttctcaataccacaattgctggtgtggaagaagcagatgttgtt
cttctagttggtacaaatccacgttttgaggcaccgctgtttaatgctagaattagaaag
agctggcttcataatgacttaaaagtggccctcatcggtagtccagtggacctcacttac
agatacgaccatctaggagactctcctaaaattctgcaagacattgcttcagggaggcat
tcattctgcgaggtcttaaaggatgctaaaaaaccaatggtggttttaggcagttctgca
ctccagagagatgatggagcagcaattcttgtagctgtgtccaacatggtacaaaagatt
cgagtgacaaccggtgttgctgcagagtggaaagttatgaatattctgcataggattgca
agccaggtagctgctttggaccttggctataaacctggggtagaagcgattaggaagaac
cctcccaaaatgctgtttcttctgggagcagatggaggttgtatcacgcgacaggacttg
ccaaaggattgtttcattgtttatcaaggacaccatggtgatgttggtgctcccatggct
gatgttattctcccaggggctgcttacacagaaaagtctgctacttatgtcaatactgag
ggcagagctcagcaaaccaaagtagcagtgacgcctcctggcttggcacgagaagactgg
aaaatcataagagctctctctgagattgcaggtatcactcttccatatgacactctggat
caagtaaggaaccgtcttgaagaggtctctcctaatctggttcgatatgatgatattgaa
gaaactaattactttcagcaagcaagtgagcttgccaagctagtaaaccaggaggttctt
gctgacccactcgttccacctcagctaactataaaagacttctatatgacagactccatt
agcagagcctcacagacaatggccaagtgtgtcaaagctgtcaccgagggcgctcaggca
gtagaggagccgtccatatgctga

KEGG   Mus musculus (mouse): 230075
Entry
230075            CDS       T01002                                 

Gene name
Ndufb6, CI-B17, Gm137
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    230075 (Ndufb6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    230075 (Ndufb6)
  09159 Environmental adaptation
   04714 Thermogenesis
    230075 (Ndufb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    230075 (Ndufb6)
   05012 Parkinson disease
    230075 (Ndufb6)
   05014 Amyotrophic lateral sclerosis
    230075 (Ndufb6)
   05016 Huntington disease
    230075 (Ndufb6)
   05020 Prion disease
    230075 (Ndufb6)
   05022 Pathways of neurodegeneration - multiple diseases
    230075 (Ndufb6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    230075 (Ndufb6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    230075 (Ndufb6)
SSDB
Motif
Pfam: NDUF_B6 Sensor
Other DBs
NCBI-GeneID: 230075
NCBI-ProteinID: NP_001028477
MGI: 2684983
Ensembl: ENSMUSG00000071014
Vega: OTTMUSG00000006581
UniProt: Q3UIU2 A2AP31
Structure
PDB: 
6G2J 6G72

Position
4; 4 A5
AA seq 128 aa
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNM
VFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPM
RDFPDQHH
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtcagggtacacgccggatgagaagctgcggctgcagcagctgcgggagctaaggaga
cgatggctgaaggaccaggagctgagtccccgggagcccgtgttgcccccgcgcaggatg
tggcccctggagcgattctgggataactttttgcgggacggggccgtgtggaagaacatg
gtctttaaggcgtaccgctccagtctcttcgctgtttctcatgtgcttatacctatgtgg
tttgttcactattatgtcaaatatcatatggctactaaaccatacaccattgttagctcg
aagcccaggatatttccaggtgatacaattctggagactggagaagtaattccaccaatg
agagattttcctgatcaacatcattga

KEGG   Mus musculus (mouse): 407785
Entry
407785            CDS       T01002                                 

Gene name
Ndufs6, BC059730, IP, IP13
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S6
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    407785 (Ndufs6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    407785 (Ndufs6)
  09159 Environmental adaptation
   04714 Thermogenesis
    407785 (Ndufs6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    407785 (Ndufs6)
   05012 Parkinson disease
    407785 (Ndufs6)
   05014 Amyotrophic lateral sclerosis
    407785 (Ndufs6)
   05016 Huntington disease
    407785 (Ndufs6)
   05020 Prion disease
    407785 (Ndufs6)
   05022 Pathways of neurodegeneration - multiple diseases
    407785 (Ndufs6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    407785 (Ndufs6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    407785 (Ndufs6)
SSDB
Motif
Pfam: zf-CHCC Thiolase_C
Other DBs
NCBI-GeneID: 407785
NCBI-ProteinID: NP_035018
MGI: 107932
Ensembl: ENSMUSG00000021606
Vega: OTTMUSG00000030547
UniProt: P52503
Structure
PDB: 
6G2J 6G72

Position
13; 13 C1
AA seq 116 aa
MAAVLTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFA
IDLIAQQPVNEVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcggcggtgctgaccttccgccggctgttgactctccccagggctgcacggggtttc
ggggttcaagtgtcgccgagcggggaaaagatcacgcataccggccaggtgtatgatgaa
aaagactacaggagggttcgttttgtagatcgtcagaaagaggtgaatgagaactttgcc
attgatttgatagcacaacagcctgtgaatgaggtggagcaccgcatcatagcctgcgat
ggaggcggtggtgccctgggccaccccaaggtgtacataaacttggacaaagaaacaaaa
acggggacatgtggctactgcggcctgcagttcaagcagcaccatcactag

KEGG   Mus musculus (mouse): 407790
Entry
407790            CDS       T01002                                 

Gene name
Ndufa4l2, BC064011
Definition
(RefSeq) Ndufa4, mitochondrial complex associated like 2
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    407790 (Ndufa4l2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    407790 (Ndufa4l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    407790 (Ndufa4l2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    407790 (Ndufa4l2)
   05012 Parkinson disease
    407790 (Ndufa4l2)
   05014 Amyotrophic lateral sclerosis
    407790 (Ndufa4l2)
   05016 Huntington disease
    407790 (Ndufa4l2)
   05020 Prion disease
    407790 (Ndufa4l2)
   05022 Pathways of neurodegeneration - multiple diseases
    407790 (Ndufa4l2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    407790 (Ndufa4l2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    407790 (Ndufa4l2)
SSDB
Motif
Pfam: B12D
Other DBs
NCBI-GeneID: 407790
NCBI-ProteinID: NP_001092259
MGI: 3039567
Ensembl: ENSMUSG00000040280
UniProt: Q4FZG9
Position
10; 10 D3
AA seq 87 aa
MAGTSLGTRFYRQIKRHPGLIPMIGFICLGMGSAGLYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF
NT seq 264 nt   +upstreamnt  +downstreamnt
atggcaggaactagtctagggacccgcttctaccggcagataaaaagacaccctgggctc
atcccaatgattggcttcatctgcttgggcatgggcagtgccggactctacttgctgcga
cttgccctgcgcagtcctgatgtctgctgggacagaaagaacaacccagagccctggaac
cgcctgagtcccaatgaccagtacaagttccttgccgtttcaaccgactacaagaagctg
aagaaggaccggccagacttctaa

KEGG   Mus musculus (mouse): 54405
Entry
54405             CDS       T01002                                 

Gene name
Ndufa1, 1810049F12Rik, MWFE
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    54405 (Ndufa1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    54405 (Ndufa1)
  09159 Environmental adaptation
   04714 Thermogenesis
    54405 (Ndufa1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54405 (Ndufa1)
   05012 Parkinson disease
    54405 (Ndufa1)
   05014 Amyotrophic lateral sclerosis
    54405 (Ndufa1)
   05016 Huntington disease
    54405 (Ndufa1)
   05020 Prion disease
    54405 (Ndufa1)
   05022 Pathways of neurodegeneration - multiple diseases
    54405 (Ndufa1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    54405 (Ndufa1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    54405 (Ndufa1)
SSDB
Motif
Pfam: MWFE
Other DBs
NCBI-GeneID: 54405
NCBI-ProteinID: NP_062316
MGI: 1929511
Ensembl: ENSMUSG00000016427
Vega: OTTMUSG00000017127
UniProt: O35683 Q545K0
Structure
PDB: 
6G2J 6G72

Position
X; X A3.3
AA seq 70 aa
MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVQYQWYLMERDRRISGVNRY
YVSKGLENID
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtggttcgagattctccctggcctcgccattatgggggtgtgcttggtcatccccggg
gtgtccactgcgtacatccacaaattcaccaacgggggcaaggaaaaacgagttgctcgt
gttcagtaccagtggtatctgatggaacgcgatagacgtatctctggagtcaatcgctac
tatgtgtccaagggcctggaaaacattgactaa

KEGG   Mus musculus (mouse): 595136
Entry
595136            CDS       T01002                                 

Gene name
Ndufs5, AI256693
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    595136 (Ndufs5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    595136 (Ndufs5)
  09159 Environmental adaptation
   04714 Thermogenesis
    595136 (Ndufs5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    595136 (Ndufs5)
   05012 Parkinson disease
    595136 (Ndufs5)
   05014 Amyotrophic lateral sclerosis
    595136 (Ndufs5)
   05016 Huntington disease
    595136 (Ndufs5)
   05020 Prion disease
    595136 (Ndufs5)
   05022 Pathways of neurodegeneration - multiple diseases
    595136 (Ndufs5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    595136 (Ndufs5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    595136 (Ndufs5)
SSDB
Motif
Pfam: Ndufs5 Cmc1 UPF0203
Other DBs
NCBI-GeneID: 595136
NCBI-ProteinID: NP_001025445
MGI: 1890889
Ensembl: ENSMUSG00000028648
Vega: OTTMUSG00000009217
UniProt: Q99LY9
Structure
PDB: 
6G2J 6G72

Position
4; 4 D2.2
AA seq 106 aa
MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEF
DDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGREEPRP
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcctttccttgacatacagaaaaagctgggcatcagcctggaccggcactttatgttc
ctaagcgcagaacagccctataagaacgccgctcggtgccacgcatttgaaaaagagtgg
atagagtgtgcacacgggatcggtgggacccgggcgaaaaaggagtgcaagatagagttc
gatgacttcgaagagtgcttgcttcggtacaaaacgatgaggcgaatgcatgatatcaag
aaacagcgggagaagctaatgaaagagggcaaatacacccctccacctcaccattcgggc
agggaggagcccaggccctga

KEGG   Mus musculus (mouse): 66046
Entry
66046             CDS       T01002                                 

Gene name
Ndufb5, 0610007D05Rik, AU015782, CI-SGDH, SGDH
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B5
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66046 (Ndufb5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66046 (Ndufb5)
  09159 Environmental adaptation
   04714 Thermogenesis
    66046 (Ndufb5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66046 (Ndufb5)
   05012 Parkinson disease
    66046 (Ndufb5)
   05014 Amyotrophic lateral sclerosis
    66046 (Ndufb5)
   05016 Huntington disease
    66046 (Ndufb5)
   05020 Prion disease
    66046 (Ndufb5)
   05022 Pathways of neurodegeneration - multiple diseases
    66046 (Ndufb5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66046 (Ndufb5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66046 (Ndufb5)
SSDB
Motif
Pfam: NDUF_B5 FRG1
Other DBs
NCBI-GeneID: 66046
NCBI-ProteinID: NP_079592
MGI: 1913296
Ensembl: ENSMUSG00000027673
Vega: OTTMUSG00000028013
UniProt: Q9CQH3
Structure
PDB: 
6G2J 6G72

Position
3; 3 A3
AA seq 189 aa
MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPS
LYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRW
IARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFID
HSPKATPDN
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcggccatgagcctgctgcagcgggcttcggtctccgcgctgacagcgctgtcttgc
cgccgcgctggtcctagactcggagtcggaagttttctcacgcggagctttccgaagact
gtcgctcctgtgcggcacagtggggaccatggcaagagactgtttgtcgtcaagccttct
ttatactatgacgctcgcttcttgaggttaatgaaattctaccttatgttgactgggatc
ccagttataattggcataacactggtgaacatatttattggtgaagccgagcttgcagaa
atcccagaaggctacatccctgaacactgggagtattacaagcatccgatatcaagatgg
atcgcccggaatttctatgatggccctgaaaagaactacgagaaaaccctggctatcctc
cagattgaatctgaaaaggctgagttacggttaaaggagcaggaagttcgaaggctgatg
cgtgcccgaggtgatggaccctggtatcaatttccaacccctgaaaaggagttcattgat
cattctccaaaggcaactcctgacaactga

KEGG   Mus musculus (mouse): 66091
Entry
66091             CDS       T01002                                 

Gene name
Ndufa3, 1010001M12Rik, 1700022J01Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A3
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66091 (Ndufa3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66091 (Ndufa3)
  09159 Environmental adaptation
   04714 Thermogenesis
    66091 (Ndufa3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66091 (Ndufa3)
   05012 Parkinson disease
    66091 (Ndufa3)
   05014 Amyotrophic lateral sclerosis
    66091 (Ndufa3)
   05016 Huntington disease
    66091 (Ndufa3)
   05020 Prion disease
    66091 (Ndufa3)
   05022 Pathways of neurodegeneration - multiple diseases
    66091 (Ndufa3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66091 (Ndufa3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66091 (Ndufa3)
SSDB
Motif
Pfam: NADHdh_A3
Other DBs
NCBI-GeneID: 66091
NCBI-ProteinID: NP_079624
MGI: 1913341
Ensembl: ENSMUSG00000035674
Vega: OTTMUSG00000023398
UniProt: Q9CQ91
Structure
PDB: 
6G2J 6G72

Position
7; 7 A1
AA seq 84 aa
MAGRISAFLKNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYASMINKATPYNYPVPVRDD
GNMPDVPSHPQDPLGPSLDWLKNL
NT seq 255 nt   +upstreamnt  +downstreamnt
atggccgggagaatctctgccttcctcaagaatgcctgggcgaaggagccggtgctggtg
gtgtccttctctgtctggggcctcgctataattatgcccatgattagcccctacaccaag
tatgctagcatgatcaacaaggccacaccctacaactacccagtgcctgtgagagatgac
gggaacatgcctgatgtgcccagccaccctcaggatcctctgggtccaagcttggactgg
ctgaagaacctgtga

KEGG   Mus musculus (mouse): 66108
Entry
66108             CDS       T01002                                 

Gene name
Ndufa9, 1010001N11Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A9
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66108 (Ndufa9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66108 (Ndufa9)
  09159 Environmental adaptation
   04714 Thermogenesis
    66108 (Ndufa9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66108 (Ndufa9)
   05012 Parkinson disease
    66108 (Ndufa9)
   05014 Amyotrophic lateral sclerosis
    66108 (Ndufa9)
   05016 Huntington disease
    66108 (Ndufa9)
   05020 Prion disease
    66108 (Ndufa9)
   05022 Pathways of neurodegeneration - multiple diseases
    66108 (Ndufa9)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66108 (Ndufa9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66108 (Ndufa9)
SSDB
Motif
Pfam: 3Beta_HSD NmrA NAD_binding_10 Epimerase RmlD_sub_bind GDP_Man_Dehyd NAD_binding_4 adh_short
Other DBs
NCBI-GeneID: 66108
NCBI-ProteinID: NP_079634
MGI: 1913358
Ensembl: ENSMUSG00000000399
Vega: OTTMUSG00000056335
UniProt: Q9DC69
Structure
PDB: 
6G2J 6G72

Position
6; 6 F3
AA seq 377 aa
MAAAVRFRVVRALPMSRPAITAAATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGDLGQLTFLEWDARDKDSIRKAV
QHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKEAGVERFIHVSHLNASMKSSSKS
LRSKAVGEKEVRSVFPEAIIIRPSDIFGREDRFLNHFANYRWFLAVPLVSLGFKTVKQPV
YVADVSKGIVNATKDPDAVGKTFAFTGPNRYLLFHLVKYIFGMTHRTFIPYPLPLFVYSW
IGKLFGLSPFEPWTTKDKVERIHISDVMPTDLPGLEDLGVQPTPLELKSIEVLRRHRTYR
WLSSEIEETKPAKTVNY
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggccgccgtccgctttcgggttgttagagcgcttccaatgtcacgtcctgccatt
actgcagcagccacttctgtgttctgtggctcatcccatcgccagcttcaccatgctgtc
atacctcacgggaaaggaggccgctcatctgtcagtggagttgtggccactgtgtttggg
gctacaggattcctgggtcgatacgttgttaaccaccttggacgaatggggtcacaagtg
atcataccatatcggtgtgatgtatatgacatcatgcaccttcgtctgatgggtgacctg
ggccagcttacctttctggaatgggatgcacgagacaaagattctatcaggaaagcagtg
cagcacagcaacgtggtcatcaatcttattgggcgggagtgggaaaccagaaactttgat
tttgaggatgtttttgtgaatattcctcgagcaatagctcaggcatccaaggaagctggg
gttgagagattcattcatgtttcacacctgaatgccagtatgaagagttcttctaagtcc
ttgaggagcaaggcagtgggagagaaggaagtgagaagtgtgtttcctgaagccatcatc
atacggccgtctgacattttcggaagggaggacaggttccttaatcactttgcaaattat
cgttggtttcttgctgtgcctcttgtttctttgggctttaagacagtgaagcagccggtg
tatgttgcagatgtttccaaggggattgttaatgcgactaaggatccagatgccgtagga
aaaacctttgccttcactgggccaaaccggtacctgctcttccacttggtgaagtacatc
tttggcatgacccatcggaccttcatcccttaccctttgccactatttgtgtatagctgg
attggcaaactctttgggctgagtccatttgagccctggacgacgaaggacaaggtggag
cggatacatatctcagacgtgatgccgaccgacctgcctggcctggaagatcttggtgtt
cagcccacaccactggagctcaagtccattgaggtgctacggcggcatcgtacctaccga
tggctgtcttctgagatcgaggaaaccaagcctgccaagacagtcaactattag

KEGG   Mus musculus (mouse): 66218
Entry
66218             CDS       T01002                                 

Gene name
Ndufb9, 1190008J14Rik, CI-B22
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66218 (Ndufb9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66218 (Ndufb9)
  09159 Environmental adaptation
   04714 Thermogenesis
    66218 (Ndufb9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66218 (Ndufb9)
   05012 Parkinson disease
    66218 (Ndufb9)
   05014 Amyotrophic lateral sclerosis
    66218 (Ndufb9)
   05016 Huntington disease
    66218 (Ndufb9)
   05020 Prion disease
    66218 (Ndufb9)
   05022 Pathways of neurodegeneration - multiple diseases
    66218 (Ndufb9)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66218 (Ndufb9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66218 (Ndufb9)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N
Other DBs
NCBI-GeneID: 66218
NCBI-ProteinID: NP_075661
MGI: 1913468
Ensembl: ENSMUSG00000022354
UniProt: Q9CQJ8
Structure
PDB: 
6G2J 6G72

Position
15; 15 D1
AA seq 179 aa
MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRA
TQLLREAEEEFWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCLDYWHPSEKAMYPDYFS
KREQWKKLRMESWDREVKQLQEETSPDGIMTEALPPARREGDLPPLWWHIVTRPRERPT
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcgttctgcgctcccccggcctacctgacccaccagcagaaggtgctgcggctgtat
aagcgcgcgctgcgccacctcgagtcatggtgtatccacagggacaagtaccggtacttt
gcttgcttgatgagagcccggtttgaagaacataagaatgagaaggatatgatgagggct
acccagctgctgagggaggcagaagaagaattctggcagaatcagcatcctcagccgtat
atcttcccagactctccggggggcacttccttcgagagatatgagtgctacaaggttcca
gaatggtgcttagattactggcatccctctgagaaagcaatgtatcctgattacttttcc
aagagagagcagtggaagaagctgaggatggagagctgggatcgggaggttaagcagctg
caggaggaaacatcacctgatggtattatgactgaagctttgcctcctgccagaagggaa
ggtgacttgcccccactgtggtggcatattgtgaccagacctcgggaacggcccacatag

KEGG   Mus musculus (mouse): 66377
Entry
66377             CDS       T01002                                 

Gene name
Ndufc1, 2310016K22Rik, KFYI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit C1
  KO
K03967  NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66377 (Ndufc1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66377 (Ndufc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    66377 (Ndufc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66377 (Ndufc1)
   05012 Parkinson disease
    66377 (Ndufc1)
   05014 Amyotrophic lateral sclerosis
    66377 (Ndufc1)
   05016 Huntington disease
    66377 (Ndufc1)
   05020 Prion disease
    66377 (Ndufc1)
   05022 Pathways of neurodegeneration - multiple diseases
    66377 (Ndufc1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66377 (Ndufc1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66377 (Ndufc1)
SSDB
Motif
Pfam: NADH_dh_m_C1
Other DBs
NCBI-GeneID: 66377
NCBI-ProteinID: NP_079799
MGI: 1913627
Ensembl: ENSMUSG00000037152
Vega: OTTMUSG00000022022
UniProt: Q9CQY9
Structure
PDB: 
6G2J 6G72

Position
3; 3 C
AA seq 76 aa
MAPSVVLRSFSRLLAPARLPSCSSTRSKFYVREPVNAKPNWLAVGLSVGASVFMWIYLIQ
THNEDVLEYKRRNGLE
NT seq 231 nt   +upstreamnt  +downstreamnt
atggcgccgtccgtagtgctgcgctcgttttcgcggctgctggcccccgcccggctgccg
agctgctcttcaacacggtcgaagttctatgtccgggagccagtcaatgccaaacctaac
tggttggcagttggactgtccgtgggcgcctcggttttcatgtggatttatctcatccaa
acacacaatgaagatgttttggagtataaaagaagaaatggattggaataa

KEGG   Mus musculus (mouse): 66414
Entry
66414             CDS       T01002                                 

Gene name
Ndufa12, 2410011G03Rik, AW112974, CI-B17.2, CIB17.2
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66414 (Ndufa12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66414 (Ndufa12)
  09159 Environmental adaptation
   04714 Thermogenesis
    66414 (Ndufa12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66414 (Ndufa12)
   05012 Parkinson disease
    66414 (Ndufa12)
   05014 Amyotrophic lateral sclerosis
    66414 (Ndufa12)
   05016 Huntington disease
    66414 (Ndufa12)
   05020 Prion disease
    66414 (Ndufa12)
   05022 Pathways of neurodegeneration - multiple diseases
    66414 (Ndufa12)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66414 (Ndufa12)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66414 (Ndufa12)
SSDB
Motif
Pfam: NDUFA12
Other DBs
NCBI-GeneID: 66414
NCBI-ProteinID: NP_079827
MGI: 1913664
Ensembl: ENSMUSG00000020022
Vega: OTTMUSG00000030989
UniProt: Q7TMF3 A0A0R4J275
Structure
PDB: 
6G2J 6G72

Position
10; 10 C2
AA seq 145 aa
MELVEVLKRGVQQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHR
WVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTNPPTARKFIWTNHKFNVSAT
PEQYVPYSTTRKKIHEWVPPSTPYK
NT seq 438 nt   +upstreamnt  +downstreamnt
atggagctggtggaggtcctgaagcgcggcgtgcagcaggtcaccggccacggcggcctg
cggggcctcctacgggttttcttcagggcaaatgatataaggattggtacactggtggga
gaagacaaatatggaaataaatactacgaagacaacaagcaattttttggccgccaccga
tgggtcatctacaccaccgagatgaacggcaaaaacacattctgggatgtggatggaagc
atggtgcctcctgagtggcaccgctggcttcactgcatgactgacgaccctccgacgact
aatccaccgactgctcgtaaattcatctggacaaaccataaattcaatgtgtctgccact
ccagagcaatacgttccttattccaccactagaaagaagattcatgaatgggttccacct
tcgacaccttacaagtga

KEGG   Mus musculus (mouse): 66416
Entry
66416             CDS       T01002                                 

Gene name
Ndufa7, 14.5kD, 14.5kDa, 2400007M02Rik, CI-B14.5a
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A7
  KO
K03951  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66416 (Ndufa7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66416 (Ndufa7)
  09159 Environmental adaptation
   04714 Thermogenesis
    66416 (Ndufa7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66416 (Ndufa7)
   05012 Parkinson disease
    66416 (Ndufa7)
   05014 Amyotrophic lateral sclerosis
    66416 (Ndufa7)
   05016 Huntington disease
    66416 (Ndufa7)
   05020 Prion disease
    66416 (Ndufa7)
   05022 Pathways of neurodegeneration - multiple diseases
    66416 (Ndufa7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66416 (Ndufa7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66416 (Ndufa7)
SSDB
Motif
Pfam: CI-B14_5a
Other DBs
NCBI-GeneID: 66416
NCBI-ProteinID: NP_075691
MGI: 1913666
Ensembl: ENSMUSG00000041881
Vega: OTTMUSG00000037210
UniProt: Q9Z1P6
Structure
PDB: 
6G2J 6G72

Position
17; 17 B1
AA seq 113 aa
MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGR
REVVPPSIIMSSQKALVSGKAAESSAMAATEKKAVTPAPPMKRWELSKDQPYL
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcgtccgctactcgcgttatccaaaagctgcggaactgggcgtctgggcaagacctg
caggcgaagctacagctgcgctaccaggagatcgccaagcggacccagccacctccgaaa
ctccccgtgggccccagtcacaagctgtccaacaattactactgtactcgtgatggccgc
cgggaagttgtgcctccctcaatcatcatgtcctcacaaaaggccctggtgtcaggcaag
gccgccgagagttctgcaatggcagccactgagaagaaggcagtgacacctgctcctccc
atgaagaggtgggagctgtccaaggaccagccatacctgtga

KEGG   Mus musculus (mouse): 66495
Entry
66495             CDS       T01002                                 

Gene name
Ndufb3, 2700033I16Rik, CI-B12
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B3
  KO
K03959  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66495 (Ndufb3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66495 (Ndufb3)
  09159 Environmental adaptation
   04714 Thermogenesis
    66495 (Ndufb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66495 (Ndufb3)
   05012 Parkinson disease
    66495 (Ndufb3)
   05014 Amyotrophic lateral sclerosis
    66495 (Ndufb3)
   05016 Huntington disease
    66495 (Ndufb3)
   05020 Prion disease
    66495 (Ndufb3)
   05022 Pathways of neurodegeneration - multiple diseases
    66495 (Ndufb3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66495 (Ndufb3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66495 (Ndufb3)
SSDB
Motif
Pfam: NDUF_B12 DUF3915
Other DBs
NCBI-GeneID: 66495
NCBI-ProteinID: NP_079873
MGI: 1913745
Ensembl: ENSMUSG00000026032
Vega: OTTMUSG00000026621
UniProt: Q9CQZ6
Structure
PDB: 
6G2J 6G72

Position
1; 1 C1.3
AA seq 104 aa
MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYM
GGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
NT seq 315 nt   +upstreamnt  +downstreamnt
atggctgctggacatggacatgaacatggacatgaacatggacatggccatggtaaaatg
gaacttccagattacagacagtggaaaattgaagggacgccattagaaacggtgcagaag
aagcttgctgcccgagggctgagggatccatgggctcgcaatgaggcttggagatacatg
ggcggctttgcaggcaacatcaccttcccgagtgtaatattaaaaggattcaaatggggg
tttgctgcgtttgtggtagctttgggggctgaatatttcctggattcccagaatggtgat
aagaagcatcactga

KEGG   Mus musculus (mouse): 66916
Entry
66916             CDS       T01002                                 

Gene name
Ndufb7, 1110002H15Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B7
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    66916 (Ndufb7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    66916 (Ndufb7)
  09159 Environmental adaptation
   04714 Thermogenesis
    66916 (Ndufb7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    66916 (Ndufb7)
   05012 Parkinson disease
    66916 (Ndufb7)
   05014 Amyotrophic lateral sclerosis
    66916 (Ndufb7)
   05016 Huntington disease
    66916 (Ndufb7)
   05020 Prion disease
    66916 (Ndufb7)
   05022 Pathways of neurodegeneration - multiple diseases
    66916 (Ndufb7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    66916 (Ndufb7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    66916 (Ndufb7)
SSDB
Motif
Pfam: NDUF_B7 Cmc1
Other DBs
NCBI-GeneID: 66916
NCBI-ProteinID: NP_080119
MGI: 1914166
Ensembl: ENSMUSG00000033938
Vega: OTTMUSG00000032846
UniProt: Q9CR61
Structure
PDB: 
6G2J 6G72

Position
8; 8 C2
AA seq 137 aa
MGAHLTRRYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCA
HYLIRLLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRRALKEA
RVAQGQGEGEVGPEVAL
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggggcgcacctgacccggcgctatctgtgggatgcctcggtggagcctgaccccgag
aagatacccagcttcccgccggacctcggctttccggagcgcaaggagcgagtgatggtg
gccacacaacaagagatgatggatgcccagctgacactgcagcaacgtgactactgtgcc
cactacctcatccggctgctgaagtgcaagcgagacagcttccccaacttcctggcctgc
aagcacgagcagcacgactgggactactgcgagcacctggattacgtgaaacgcatgaag
gagtttgaacgtgagcggcgactgctccaaaggaagaagcgaagggcactgaaggaagca
cgggtagcccaaggccagggagaaggagaggtgggccctgaggtggccctgtag

KEGG   Mus musculus (mouse): 67130
Entry
67130             CDS       T01002                                 

Gene name
Ndufa6, 14kD, 14kDa, 2700038D15Rik, B230217P19Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67130 (Ndufa6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    67130 (Ndufa6)
  09159 Environmental adaptation
   04714 Thermogenesis
    67130 (Ndufa6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67130 (Ndufa6)
   05012 Parkinson disease
    67130 (Ndufa6)
   05014 Amyotrophic lateral sclerosis
    67130 (Ndufa6)
   05016 Huntington disease
    67130 (Ndufa6)
   05020 Prion disease
    67130 (Ndufa6)
   05022 Pathways of neurodegeneration - multiple diseases
    67130 (Ndufa6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67130 (Ndufa6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67130 (Ndufa6)
SSDB
Motif
Pfam: Complex1_LYR Complex1_LYR_2 Herpes_gp2
Other DBs
NCBI-GeneID: 67130
NCBI-ProteinID: NP_080263
MGI: 1914380
Ensembl: ENSMUSG00000022450
UniProt: Q9CQZ5
Structure
PDB: 
6G2J 6G72

Position
15; 15 E1
AA seq 131 aa
MAAAATGLRQAAAAAASTSVKPIFSRDLNEAKRRVRELYRAWYREVPNTVHLMQLDITVK
QGRDKVREMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRTHVMRFFHETETPRPKD
FLSKFYMGHDP
NT seq 396 nt   +upstreamnt  +downstreamnt
atggcggccgcggccaccggcctgcgccaagctgctgctgcggcagccagtacctcggtg
aagcccattttcagtcgcgacctgaacgaggccaagcggagggtgcgcgagctctaccgc
gcttggtatcgggaggtgccgaacaccgtgcacttaatgcagctggatatcacggtgaaa
caaggacgggataaagtccgagaaatgttcatgaagaatgcccatgtcacagaccccaga
gtggttgatctgctggtcattaagggaaagatggagctccaggaaaccatcaaagtatgg
aagcagcggacacacgttatgcggtttttccatgaaacagaaacaccaaggccaaaggat
ttcttatctaagttctatatgggccatgacccatga

KEGG   Mus musculus (mouse): 67184
Entry
67184             CDS       T01002                                 

Gene name
Ndufa13, 2700054G14Rik, AU022060, CDA01, CDA016, CGI-3, CGI-39, CI-B16.6, GRIM-, GRIM-19, Grim, Grim19
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67184 (Ndufa13)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    67184 (Ndufa13)
  09159 Environmental adaptation
   04714 Thermogenesis
    67184 (Ndufa13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67184 (Ndufa13)
   05012 Parkinson disease
    67184 (Ndufa13)
   05014 Amyotrophic lateral sclerosis
    67184 (Ndufa13)
   05016 Huntington disease
    67184 (Ndufa13)
   05020 Prion disease
    67184 (Ndufa13)
   05022 Pathways of neurodegeneration - multiple diseases
    67184 (Ndufa13)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67184 (Ndufa13)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67184 (Ndufa13)
SSDB
Motif
Pfam: GRIM-19 Planc_extracel
Other DBs
NCBI-GeneID: 67184
NCBI-ProteinID: NP_075801
MGI: 1914434
Ensembl: ENSMUSG00000036199
Vega: OTTMUSG00000033931 OTTMUSG00000062221
UniProt: Q9ERS2
Structure
PDB: 
6G2J 6G72

Position
8; 8 B3.3
AA seq 144 aa
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRL
LIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPL
IGEMYGLRTKEEMSNANFGFTWYT
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcggcgtcgaaggtgaagcaggacatgcccccgccagggggctacggccccatcgac
tacaagcggaacctgccccgccggggactgtcggggtacagcatgtttgctgtgggcatc
ggggccttgatctttggctactggagaatgatgaggtggaaccaggagcgcaggcgcctg
ctgattgaggacttggaggccaggatcgccctcatgccgctcttccaggcagagaaggac
cggaggaccctgcagattctccgggaaaacctggaggaggaagccatcatcatgaaggat
gtgcccaactggaaggtgggcgagtctgtgttccataccacacgatgggtgccacccctc
attggcgagatgtatgggttgcgcaccaaggaggagatgagcaatgccaacttcggcttc
acctggtacacttag

KEGG   Mus musculus (mouse): 67264
Entry
67264             CDS       T01002                                 

Gene name
Ndufb8, 2900010I05Rik, AI987932, CI-ASHI
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B8
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67264 (Ndufb8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    67264 (Ndufb8)
  09159 Environmental adaptation
   04714 Thermogenesis
    67264 (Ndufb8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67264 (Ndufb8)
   05012 Parkinson disease
    67264 (Ndufb8)
   05014 Amyotrophic lateral sclerosis
    67264 (Ndufb8)
   05016 Huntington disease
    67264 (Ndufb8)
   05020 Prion disease
    67264 (Ndufb8)
   05022 Pathways of neurodegeneration - multiple diseases
    67264 (Ndufb8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67264 (Ndufb8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67264 (Ndufb8)
SSDB
Motif
Pfam: NDUF_B8
Other DBs
NCBI-GeneID: 67264
NCBI-ProteinID: NP_080337
MGI: 1914514
Ensembl: ENSMUSG00000025204
Vega: OTTMUSG00000036225
UniProt: Q9D6J5
Structure
PDB: 
6G2J 6G72

Position
19; 19 C3
AA seq 186 aa
MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVE
DYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTS
PTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEP
VVHYDI
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctgccgcccgggctgcggccctgggagtccgatggctgcagaggacaacccggggc
gtggtgccactggaggcacggagagccttccatatgaccaaggacatgttgccggggtca
tatcctaggaccccagaggaacgcgccgcggccgccaagaagtataacatgcgagtggaa
gactacgagccataccccgatgatggcatggggtatggcgactacccgatgctccccaac
cgatcacagcatgagagggatccgtggtatcagtgggaccactcagaactcaggatgaac
tggggtgaaccgatacactgggacctagacatgtacatcaggaatcgtgtggacacgtca
cctacccctgtgtcctgggatgtcatgtgtaaacatctcttcggctttgtggctttcatg
gttttcatgttctgggtagggcacgtgttcccttcctaccagcctgtgggtccgaagcag
tacccttacaataatctgtacctggagcggggtggtgatcctaccaaagagcctgagccc
gtggttcactatgatatctga

KEGG   Mus musculus (mouse): 67273
Entry
67273             CDS       T01002                                 

Gene name
Ndufa10, 2900053E13Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A10
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    67273 (Ndufa10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    67273 (Ndufa10)
  09159 Environmental adaptation
   04714 Thermogenesis
    67273 (Ndufa10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67273 (Ndufa10)
   05012 Parkinson disease
    67273 (Ndufa10)
   05014 Amyotrophic lateral sclerosis
    67273 (Ndufa10)
   05016 Huntington disease
    67273 (Ndufa10)
   05020 Prion disease
    67273 (Ndufa10)
   05022 Pathways of neurodegeneration - multiple diseases
    67273 (Ndufa10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    67273 (Ndufa10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    67273 (Ndufa10)
SSDB
Motif
Pfam: dNK Thymidylate_kin TsaE Cytidylate_kin Cytidylate_kin2 AAA_33
Other DBs
NCBI-GeneID: 67273
NCBI-ProteinID: NP_077159
MGI: 1914523
Ensembl: ENSMUSG00000026260
Vega: OTTMUSG00000021762
UniProt: Q99LC3
Structure
PDB: 
6G2J 6G72

Position
1; 1 D
AA seq 355 aa
MALRLLRLVPASAPARGLAAGAQRVGRIHTSVHCKLRYGLLAAILGDKTTKKLHEYSRVI
TVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPLDIEFSGSCSLEKFYDD
PKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGYIR
KQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQDIENA
YKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLKQDDWTFHYLRMLVQD
KTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYAPGYNAEVGDKWIWLK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggccttgaggttgctgagactcgtcccggcgtcggctcccgcgcgcggcctcgcggcc
ggagcccagcgcgtgggacgaattcataccagtgtgcactgcaagctgaggtatgggctt
ttggccgccattcttggtgataagacaaccaaaaagctgcatgagtacagccgagtgata
acagtagatgggaacatatgctctgggaaaaacaagctcgcaaaggagatcgcacagcaa
ctaggcatgaagcactacccagaagcagggatacagtactcaagcaccaccacaggcgat
ggaaggcccctcgacatagagtttagtggcagctgtagtttagagaaattttatgatgat
cccaagagcaacgatggcaacagctaccgcctgcagtcctggctgtatgccagccgcctt
cttcagtatgcagatgccctggagcacctgctgagcacaggacaaggtgtggtcttggag
cgctccatctacagtgactttgtcttcctggaggcaatgtacaaccagggctatatccga
aagcagtgtgtggaccactataatgaaattaagcggctcactctcccggagtacctgcca
ccacacgcagtcatctatatcgatgtgcccgtgccggaggtacagagcaggatccagaag
aaaggagatccacatgaaatgaaggtcacctctgcctatctccaggacatcgagaatgcg
tacaagaaaaccttcctccccaaaatgagtgaaatgtgtgaggtgttggtgtacgattcc
tgggaagctgaagacccaaccaaggtggtagaggacattgaataccttaagtacaacaaa
gggccttggctgaaacaggacgactggacctttcactacctgcggatgctggttcaggat
aagacagaagtgctgaattacacgaccattccggtctacctcccagaaatcactattgga
gctcatcagggtagccggatctacaacagcttcagagagctgccaggccgcaagtatgcc
cctgggtacaatgccgaggtgggtgacaagtggatctggctgaagtga

KEGG   Mus musculus (mouse): 68194
Entry
68194             CDS       T01002                                 

Gene name
Ndufb4, 0610006N12Rik, 1300010H20Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B4
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68194 (Ndufb4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68194 (Ndufb4)
  09159 Environmental adaptation
   04714 Thermogenesis
    68194 (Ndufb4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68194 (Ndufb4)
   05012 Parkinson disease
    68194 (Ndufb4)
   05014 Amyotrophic lateral sclerosis
    68194 (Ndufb4)
   05016 Huntington disease
    68194 (Ndufb4)
   05020 Prion disease
    68194 (Ndufb4)
   05022 Pathways of neurodegeneration - multiple diseases
    68194 (Ndufb4)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68194 (Ndufb4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68194 (Ndufb4)
SSDB
Motif
Pfam: NDUF_B4 Phage_holin_2_4
Other DBs
NCBI-GeneID: 68194
NCBI-ProteinID: NP_080886
MGI: 1915444
Ensembl: ENSMUSG00000022820
Vega: OTTMUSG00000025712
UniProt: Q9CQC7
Structure
PDB: 
6G2J 6G72

Position
16; 16 B3
AA seq 129 aa
MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHI
EDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGK
LDRKFNISY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcgggttccaagtataagcctgcgcccctggccactctccccagtaccctcgaccct
gccgagtatgacgtgtctccggagaccagaagggcgcaggtcgagcgcttgagcataagg
gcccggcttaaacgggagtatctgcttcagtacaacgaccccaaacgcgtgtcgcacatc
gaggatcctgccttgattcgctggacctatgcaagatcagcaaatatttatcctaatttc
aggcccactcccaagaactcacttttaggagctgtggcagggtttgggcccctcatcttc
tggtattatgttttcaaaacagacagggacagaaaggaaagacttatccaggaaggaaaa
ctggacagaaaatttaacatctcctactaa

KEGG   Mus musculus (mouse): 68197
Entry
68197             CDS       T01002                                 

Gene name
Ndufc2, 1810004I06Rik, 2010300P09Rik, G1, R75094
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit C2
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68197 (Ndufc2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68197 (Ndufc2)
  09159 Environmental adaptation
   04714 Thermogenesis
    68197 (Ndufc2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68197 (Ndufc2)
   05012 Parkinson disease
    68197 (Ndufc2)
   05014 Amyotrophic lateral sclerosis
    68197 (Ndufc2)
   05016 Huntington disease
    68197 (Ndufc2)
   05020 Prion disease
    68197 (Ndufc2)
   05022 Pathways of neurodegeneration - multiple diseases
    68197 (Ndufc2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68197 (Ndufc2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68197 (Ndufc2)
SSDB
Motif
Pfam: NDUF_C2
Other DBs
NCBI-GeneID: 68197
NCBI-ProteinID: NP_077182
MGI: 1344370
Ensembl: ENSMUSG00000030647
Vega: OTTMUSG00000029541
UniProt: Q9CQ54
Structure
PDB: 
6G2J 6G72

Position
7; 7 E1
AA seq 120 aa
MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHR
QLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatgaacggccggccgggccatgagcccttaaaattcttgccggacgaggcccggagc
ctgcccccgcccaagctgaacgacccgcggcttgtctacatgggcttgttgggctactgc
acgggcctgatggacaacatgctgcggatgcgaccggtgatgagagcaggtttgcaccgc
cagcttctgttcgttacgtcctttgtctttgctggatacttttatttaaaacgtcaaaac
tatttgtatgctgtgaaggaccatgacatgtttggttatataaaattacacccagaagat
tttcctgaaaaagagaagaaaacctatgctgaaattcttgagccattccatccagtgcgt
tga

KEGG   Mus musculus (mouse): 68198
Entry
68198             CDS       T01002                                 

Gene name
Ndufb2, 1810011O01Rik, 8kD, 8kDa, AGGG, AI325567, CI-AGGG
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B2
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68198 (Ndufb2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68198 (Ndufb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    68198 (Ndufb2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68198 (Ndufb2)
   05012 Parkinson disease
    68198 (Ndufb2)
   05014 Amyotrophic lateral sclerosis
    68198 (Ndufb2)
   05016 Huntington disease
    68198 (Ndufb2)
   05020 Prion disease
    68198 (Ndufb2)
   05022 Pathways of neurodegeneration - multiple diseases
    68198 (Ndufb2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68198 (Ndufb2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68198 (Ndufb2)
SSDB
Motif
Pfam: NADH_B2
Other DBs
NCBI-GeneID: 68198
NCBI-ProteinID: NP_080888
MGI: 1915448
Ensembl: ENSMUSG00000002416
Vega: OTTMUSG00000026896
UniProt: Q9CPU2
Structure
PDB: 
6G2J 6G72

Position
6; 6 B1
AA seq 105 aa
MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEF
LSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtctgcgctcacccgtctggtacctttcggccgcgtcggaggccgcctgctccggggc
tgccgcgcgcgggcggctggagacagtggagtccgtcacgctggcggtggtgtacatatt
cagccccggtacagggagtttccccagcttacccggtcccaggtgatccagggtgagttc
ttaagctcactcatgtggttctggattctttggcgattttggcatgactcggatgctgtg
ctgggtcacttttcatatccagatccttcacagtggacagatgaagaactgggaatccct
cctgatgacgaggactga

KEGG   Mus musculus (mouse): 68202
Entry
68202             CDS       T01002                                 

Gene name
Ndufa5, 2900002J19Rik, CI-13kD-B
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A5
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68202 (Ndufa5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68202 (Ndufa5)
  09159 Environmental adaptation
   04714 Thermogenesis
    68202 (Ndufa5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68202 (Ndufa5)
   05012 Parkinson disease
    68202 (Ndufa5)
   05014 Amyotrophic lateral sclerosis
    68202 (Ndufa5)
   05016 Huntington disease
    68202 (Ndufa5)
   05020 Prion disease
    68202 (Ndufa5)
   05022 Pathways of neurodegeneration - multiple diseases
    68202 (Ndufa5)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68202 (Ndufa5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68202 (Ndufa5)
SSDB
Motif
Pfam: ETC_C1_NDUFA5
Other DBs
NCBI-GeneID: 68202
NCBI-ProteinID: NP_080890
MGI: 1915452
Ensembl: ENSMUSG00000023089
Vega: OTTMUSG00000026861
UniProt: Q9CPP6
Structure
PDB: 
6G2J 6G72

Position
6; 6 A3.1
AA seq 116 aa
MAGLLKKTTGLVGLAVCDTPHERLTILYTKTLDILKHFPKHAAYRKYTEQITNEKLDMVK
AEPDVKKLEALLQGGEVEEVILQAEKELSLARKMLKWKPWEPLVEEPPANQWKWPI
NT seq 351 nt   +upstreamnt  +downstreamnt
atggcgggcttgctgaaaaagacaactggcctggtggggttggcggtgtgcgacactcca
cacgagaggctcacaatattgtatacaaagactcttgatattctgaagcactttcctaaa
catgcagcctatagaaaatacacagaacagatcaccaacgagaagctggatatggtcaag
gcggagccagatgttaaaaaattagaagccttgcttcagggtggtgaagtggaagaggtg
attcttcaggctgaaaaagaactaagtctggcaaggaaaatgttgaagtggaagccatgg
gagccattggtggaagagccgcctgctaaccagtggaagtggccaatatga

KEGG   Mus musculus (mouse): 68342
Entry
68342             CDS       T01002                                 

Gene name
Ndufb10, 0610011B04Rik, 22kD, 22kDa, PDSW
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68342 (Ndufb10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68342 (Ndufb10)
  09159 Environmental adaptation
   04714 Thermogenesis
    68342 (Ndufb10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68342 (Ndufb10)
   05012 Parkinson disease
    68342 (Ndufb10)
   05014 Amyotrophic lateral sclerosis
    68342 (Ndufb10)
   05016 Huntington disease
    68342 (Ndufb10)
   05020 Prion disease
    68342 (Ndufb10)
   05022 Pathways of neurodegeneration - multiple diseases
    68342 (Ndufb10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68342 (Ndufb10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68342 (Ndufb10)
SSDB
Motif
Pfam: NDUFB10
Other DBs
NCBI-GeneID: 68342
NCBI-ProteinID: NP_080960
MGI: 1915592
Ensembl: ENSMUSG00000040048
Vega: OTTMUSG00000029227
UniProt: Q9DCS9
Structure
PDB: 
6G2J 6G72

Position
17; 17 A3.3
AA seq 176 aa
MPDSWDKDVYPEPPSRTPAPSPQTSLPNPITYLTKAYDLVVDWPVTLVREFIERQHAKNR
TYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKVDQEIMNIIQERLKACQQREGEN
YQQNCAKELEQFTKVTKAYQDRYLDLGAYYSARKCLAKQKQRMLEERKAARQEAAA
NT seq 531 nt   +upstreamnt  +downstreamnt
atgccagattcttgggacaaggatgtgtacccggagcccccgagccgcacgcctgctccc
tcgccgcagacctcgctccctaaccccatcacctacttgacgaaggcctacgacctcgtc
gtggactggcccgtgaccctcgtgagagagtttattgaacgacagcatgccaagaaccga
acctactactaccaccgacagtaccgtcgagtgccagacatcacagaatgcaaagagggt
gatgttctgtgtatctatgaggctgagatgcagtggagaagggacttcaaagttgaccag
gagatcatgaacatcatccaggagagactgaaggcttgtcagcagagggagggagagaac
taccagcagaactgtgccaaggaactggagcagttcaccaaagtgactaaagcctaccag
gaccgctacttggacctgggagcctactattctgccagaaagtgtctggcaaagcagaag
cagaggatgctggaagaaaggaaggctgcgaggcaggaggctgctgcctag

KEGG   Mus musculus (mouse): 68349
Entry
68349             CDS       T01002                                 

Gene name
Ndufs3, 0610010M09Rik, CI-30kD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S3
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68349 (Ndufs3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68349 (Ndufs3)
  09159 Environmental adaptation
   04714 Thermogenesis
    68349 (Ndufs3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68349 (Ndufs3)
   05012 Parkinson disease
    68349 (Ndufs3)
   05014 Amyotrophic lateral sclerosis
    68349 (Ndufs3)
   05016 Huntington disease
    68349 (Ndufs3)
   05020 Prion disease
    68349 (Ndufs3)
   05022 Pathways of neurodegeneration - multiple diseases
    68349 (Ndufs3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68349 (Ndufs3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68349 (Ndufs3)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     68349 (Ndufs3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 68349
NCBI-ProteinID: NP_080964
MGI: 1915599
Ensembl: ENSMUSG00000005510
Vega: OTTMUSG00000014317
UniProt: Q9DCT2
Structure
PDB: 
6G2J 6G72

Position
2; 2 E1
AA seq 263 aa
MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAF
GEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPT
RQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNH
PDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEA
FPAYRQPPESLKLEAGDKKPETK
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcggcggctgcagccagggtctggtgtcgtgggctcttgggggccgcttccgtaggc
aggggggctgggcgaccctccgtgctgtggcagcacgtaagaagggagagcgcggcggct
gacaagcgccccactgtcagaccccggagtgatgtgacccacaagcagctctcagcattt
ggagagtatgtggctgaaatcttacccaagtatgtccaacaagttcaggtgtcctgcctt
gatgagttagaaatctgtatccatcccgatggagtcatcccaacgctgacttttctcagg
gatcacaccaatgcacaattcaaatccttggctgacttgacggcagtggatgtcccaact
cggcagaaccgttttgagattgtctacaacctgctgtctctgcggttcaactctaggatt
cgtgtgaagacctatgcagatgagctgacacccattgactctatagtgtctgtgcacatc
gcggccaattggtatgagagggaggtctgggacatgtttggagttttcttttttaaccac
cctgatttaagaaggatcctgacagattatggcttcgagggacatcctttccggaaagac
tttcccctcactggctatgttgagcttcgttacgacgatgaggtaaagcgggtagtggct
gaaccagtggagctggcacaagaattccgcaagtttgacctgaacagcccctgggaggct
ttccctgcctatcgccagcctcctgagagtctcaagctcgaagctggagacaagaagcct
gaaaccaagtaa

KEGG   Mus musculus (mouse): 68375
Entry
68375             CDS       T01002                                 

Gene name
Ndufa8, 0610033L03Rik, AW261656, CI-19kD, CI-PGIV
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A8
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    68375 (Ndufa8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    68375 (Ndufa8)
  09159 Environmental adaptation
   04714 Thermogenesis
    68375 (Ndufa8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    68375 (Ndufa8)
   05012 Parkinson disease
    68375 (Ndufa8)
   05014 Amyotrophic lateral sclerosis
    68375 (Ndufa8)
   05016 Huntington disease
    68375 (Ndufa8)
   05020 Prion disease
    68375 (Ndufa8)
   05022 Pathways of neurodegeneration - multiple diseases
    68375 (Ndufa8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    68375 (Ndufa8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    68375 (Ndufa8)
SSDB
Motif
Pfam: CHCH Cmc1 CX9C
Other DBs
NCBI-GeneID: 68375
NCBI-ProteinID: NP_080979
MGI: 1915625
Ensembl: ENSMUSG00000026895
Vega: OTTMUSG00000012097
UniProt: Q9DCJ5
Structure
PDB: 
6G2J 6G72

Position
2; 2 B
AA seq 172 aa
MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEG
KLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRP
DLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccggggatagtggagctgccaactctggaagagctgaaagtggaggaggtgaaagtc
agctcagctgtgcttaaagctgccgcccatcactatggggctcagtgcgataaaaccaat
aaggagtttatgctgtgccgctgggaagagaaggacccaaggcgctgcctgaaggagggc
aagctggtcaacggctgtgcgctgaacttcttcaggcagataaagagtcactgtgcggag
cctttcacagagtactggacttgccttgattactccaacatgcagctgtttcgtcactgc
cgccagcagcaggcaaagtttgaccagtgtgtgctggacaaactgggctgggtgaggccg
gacctggggcagttgtctaaggtcaccaaagtgaaaacagatcgtcctttgccagagaat
ccttatcactcaagagcaaggccagagcccaaccctgtgattgaaggggatctgaaaccc
gccaagcacggcacccgcttttttttctggaccgtgtag

KEGG   Mus musculus (mouse): 69875
Entry
69875             CDS       T01002                                 

Gene name
Ndufa11, 2010012C24Rik, AV006275, B14.7
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A11
  KO
K03956  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    69875 (Ndufa11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    69875 (Ndufa11)
  09159 Environmental adaptation
   04714 Thermogenesis
    69875 (Ndufa11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    69875 (Ndufa11)
   05012 Parkinson disease
    69875 (Ndufa11)
   05014 Amyotrophic lateral sclerosis
    69875 (Ndufa11)
   05016 Huntington disease
    69875 (Ndufa11)
   05020 Prion disease
    69875 (Ndufa11)
   05022 Pathways of neurodegeneration - multiple diseases
    69875 (Ndufa11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    69875 (Ndufa11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    69875 (Ndufa11)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 69875
NCBI-ProteinID: NP_081520
MGI: 1917125
Ensembl: ENSMUSG00000002379
UniProt: G5E814
Structure
PDB: 
6G2J 6G72

Position
17; 17 D
AA seq 143 aa
MAMVKRFFESYHEVPDGTQCHRKTYITTALGGICGIIGSAYSVSLNPADSTLEAVARVGR
YTFTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAMGCVYM
GTAAALFKIGKLEGWELFPTPKV
NT seq 432 nt   +upstreamnt  +downstreamnt
atggcgatggtgaagcggttctttgaatcttaccatgaggtccccgacggcacccagtgt
catcgcaagacctacatcaccacggccttaggcggcatttgcggcataatcggctccgct
tacagcgtctcactcaaccccgcagattccaccctggaagcagtggccagagtcggccgg
tacacattcactgcagctgctattggagcgatgtttggccttaccacctgtgtcagtgcc
caggtccgagagaagccagatgaccccctgaactacttcattggtggctgcgcgggaggc
ctgacattgggagctcgcactcacagctatgggacagcagccatgggctgtgtctacatg
ggcactgcggccgccctgttcaagatcggcaagctggaaggctgggagttgttccctacc
cccaaggtgtga

KEGG   Mus musculus (mouse): 70316
Entry
70316             CDS       T01002                                 

Gene name
Ndufab1, 2210401F17Rik, 2310039H15Rik, 2610003B19Rik, 8kD, 8kDa, 9130423F15Rik, ACP, CI-SDAP, SDAP
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit AB1
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
mmu_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    70316 (Ndufab1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    70316 (Ndufab1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    70316 (Ndufab1)
  09159 Environmental adaptation
   04714 Thermogenesis
    70316 (Ndufab1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    70316 (Ndufab1)
   05012 Parkinson disease
    70316 (Ndufab1)
   05014 Amyotrophic lateral sclerosis
    70316 (Ndufab1)
   05016 Huntington disease
    70316 (Ndufab1)
   05020 Prion disease
    70316 (Ndufab1)
   05022 Pathways of neurodegeneration - multiple diseases
    70316 (Ndufab1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    70316 (Ndufab1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    70316 (Ndufab1)
SSDB
Motif
Pfam: PP-binding PP-binding_2
Other DBs
NCBI-GeneID: 70316
NCBI-ProteinID: NP_082453
MGI: 1917566
Ensembl: ENSMUSG00000030869
Vega: OTTMUSG00000026510
UniProt: Q9CR21 Q569N0
Structure
PDB: 
6G2J 6G72

Position
7; 7 F2
AA seq 156 aa
MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGT
VTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcgtctcgtgtcctctgcgcctgtgtccgccgcctgcccgcggccttcgcgccgctg
ccccggcttcccacgttggccttggcgcggccgctcagcaccaccctatgccctgaggga
atccggaggagacccggggctctgcagtccgccttggcgctcgcgcaggtgcctggaaca
gtcacacatttgtgccgccagtacagtgacgcacccccactgacgttagacggaatcaag
gaccgagttctgtatgtcttgaaactctatgataagattgatccagaaaagctctccgta
aattctcattttatgaaggacctgggcttagacagtttggaccaagtggaaattattatg
gccatggaagacgaatttgggtttgaaattcctgatatagatgcagagaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtgtatgaataa

KEGG   Mus musculus (mouse): 72900
Entry
72900             CDS       T01002                                 

Gene name
Ndufv2, 2900010C23Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V2
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    72900 (Ndufv2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    72900 (Ndufv2)
  09159 Environmental adaptation
   04714 Thermogenesis
    72900 (Ndufv2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    72900 (Ndufv2)
   05012 Parkinson disease
    72900 (Ndufv2)
   05014 Amyotrophic lateral sclerosis
    72900 (Ndufv2)
   05016 Huntington disease
    72900 (Ndufv2)
   05020 Prion disease
    72900 (Ndufv2)
   05022 Pathways of neurodegeneration - multiple diseases
    72900 (Ndufv2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    72900 (Ndufv2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    72900 (Ndufv2)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     72900 (Ndufv2)
SSDB
Motif
Pfam: 2Fe-2S_thioredx
Other DBs
NCBI-GeneID: 72900
NCBI-ProteinID: NP_082664
MGI: 1920150
Ensembl: ENSMUSG00000024099
Vega: OTTMUSG00000016284
UniProt: Q9D6J6
Structure
PDB: 
6G2J 6G72

Position
17 35.26 cM; 17 E1.1
AA seq 248 aa
MFSLALRARATGLAAQWGRHARNLHKTAVHNGAGGALFVHRDTPENNPDTPFDFTPENYK
RIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTM
YNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACV
NAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGP
GFGVQAGL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgttctccttggcgctgcgggccagggcgaccggcctcgctgctcagtggggaagacat
gcaaggaatttgcataagacagcagtgcacaatggtgctggaggagccttatttgtgcat
agagatactcctgagaataacccagatactccatttgatttcacaccagaaaactataag
aggatagaggcaatagtaaaaaactacccagaagggcatcaagccgctgctgtgcttcca
gtcctggatctcgcccaaaggcagaatggatggctacctatctccgctatgaacaaggtg
gctgaagttttacaagtacctccaatgagagtatatgaagtagcaactttttatacaatg
tataatcgaaagccagttgggaagtaccatatccaggtctgcactactacaccttgcatg
ctgcgagattctgacagcatattggagacccttcagagaaagcttggaataaaggttgga
gagactacacctgacaaacttttcactcttatagaagtggaatgtttaggggcctgtgta
aatgcaccgatggttcaaataaatgacaactactatgaggatctgacacccaaggatatt
gaagagattattgatgaactcaaagctggaaaagttcccaaaccagggccaaggagtggc
cgcttctgttgtgagccagctggaggccttacttctttgactgaaccacccaaaggacct
ggctttggtgtgcaagcaggcctttaa

KEGG   Mus musculus (mouse): 75406
Entry
75406             CDS       T01002                                 

Gene name
Ndufs7, 1010001M04Rik, CI-20kD
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit S7
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    75406 (Ndufs7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    75406 (Ndufs7)
  09159 Environmental adaptation
   04714 Thermogenesis
    75406 (Ndufs7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    75406 (Ndufs7)
   05012 Parkinson disease
    75406 (Ndufs7)
   05014 Amyotrophic lateral sclerosis
    75406 (Ndufs7)
   05016 Huntington disease
    75406 (Ndufs7)
   05020 Prion disease
    75406 (Ndufs7)
   05022 Pathways of neurodegeneration - multiple diseases
    75406 (Ndufs7)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    75406 (Ndufs7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    75406 (Ndufs7)
Enzymes [BR:mmu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     75406 (Ndufs7)
SSDB
Motif
Pfam: Oxidored_q6
Other DBs
NCBI-GeneID: 75406
NCBI-ProteinID: NP_083548
MGI: 1922656
Ensembl: ENSMUSG00000020153
Vega: OTTMUSG00000000012
UniProt: Q9DC70
Structure
PDB: 
6G2J 6G72

Position
10 C1; 10 39.72 cM
AA seq 224 aa
MAALAAPGLLSVRILGLRTAQVQLRRVHQSVATEGPSPSPSPSLSSTQSAVSKAGAGAVV
PKLSHLPRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVV
FRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRG
CDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcggcgctggcggctcctggcctgctctctgtacggatcctgggtctgcgcacagca
caggtccagctgcgcagagttcatcagagtgtagccactgagggcccgagcccgagccca
agcccgagcctgagcagcacacagtctgctgtgtccaaggctggagctggagccgtggtc
cccaagctctctcatcttccccgaagccgggctgagtatgtggtgaccaagctggatgac
ctcatcaactgggcacgccggagctccctgtggcctatgaccttcggcctggcgtgctgt
gccgtggagatgatgcacatggctgcgccgcgctatgacatggaccgcttcggtgtggtg
ttccgtgccagtccgcgccaggctgatgtgatgattgtagctggcacgcttaccaacaag
atggcccccgcgctccgaaaggtgtacgaccagatgcccgaaccccgctatgtggtgtcc
atggggagctgtgccaatggcggtggctactaccactactcctactcggttgttcgtggc
tgtgaccgcattgtgccagtggacatctatgtgccaggctgcccgcccacggccgaagca
ctcctttatggcatcttgcagctgcaacggaagatcaagcgtgaacagaagctgaagatc
tggtaccgcaggtag

KEGG   Mus musculus (mouse): 78330
Entry
78330             CDS       T01002                                 

Gene name
Ndufv3, 1500032D16Rik
Definition
(RefSeq) NADH:ubiquinone oxidoreductase core subunit V3
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    78330 (Ndufv3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    78330 (Ndufv3)
  09159 Environmental adaptation
   04714 Thermogenesis
    78330 (Ndufv3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    78330 (Ndufv3)
   05012 Parkinson disease
    78330 (Ndufv3)
   05014 Amyotrophic lateral sclerosis
    78330 (Ndufv3)
   05016 Huntington disease
    78330 (Ndufv3)
   05020 Prion disease
    78330 (Ndufv3)
   05022 Pathways of neurodegeneration - multiple diseases
    78330 (Ndufv3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    78330 (Ndufv3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    78330 (Ndufv3)
SSDB
Motif
Pfam: NDUFV3
Other DBs
NCBI-GeneID: 78330
NCBI-ProteinID: NP_001077360
MGI: 1890894
Ensembl: ENSMUSG00000024038
Vega: OTTMUSG00000047655
UniProt: Q8BK30
Structure
PDB: 
6G2J 6G72

Position
17; 17 B1
AA seq 104 aa
MAVSLLLRGGRIRALKAVLLEARVFPGELVSVVRLSTESEKSAKEKELHPKTQSVLKEPE
PTDTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSSGRESPRH
NT seq 315 nt   +upstreamnt  +downstreamnt
atggcggtctctctcctcctgcggggaggacggatccgggcgctgaaggctgtgctcctg
gaggcaagggtgttcccgggagaactggtttctgtagtgaggctgtctacagagtcagag
aagagtgcaaaggagaaagagctacatcccaagacacaaagtgtgctcaaagagcccgag
ccgactgacaccaccacctacaagaacctgcagcaccatgactacaacacatacaccttc
ctggacctgaacctggacctctccaaattcaggctgccacagccgtcttcaggacgagag
tcacctcggcactga

DBGET integrated database retrieval system