KEGG   Mus musculus (mouse): 100041734Help
Entry
100041734         CDS       T01002                                 

Gene name
4930522L14Rik, Gm42152
Definition
(RefSeq) RIKEN cDNA 4930522L14 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf-C2H2_11 Zn-ribbon_8 C1_1 DUF3268 C1_4 zinc_ribbon_15 Zn_ribbon_SprT zf-DNA_Pol
Motif
Other DBs
NCBI-GeneID: 100041734
NCBI-ProteinID: XP_030110874
MGI: 1925270
Vega: OTTMUSG00000022585
Position
5; 5 F
AA seq 464 aa AA seqDB search
MLETYRNLNAVGYNWEDHNIEEHCQSSRRHGRHERSFTGENPYEGIQCGEAFVHHNSLRM
QKITHTGEKCYKCSQCGKAYAGPHTLQIHERTHSGEKAYECNQCTKSFASHGQLRKHERI
HTRGKSYKCNQCCKAFAYPGNLQMHKRMHTEHKPYECNQCSKSFASHGQLRMHERIHTRG
KSYKCNQCSKAFVYPGNLRMHKRMHTEHKLYECNQCSKSFVSHGQLRIHERIHTEEKPYQ
CNQCSKTFVCHGQLRIHERTHTREKPYECNQCSKTFASHGQLQIHERIHTGEKPYKCDQC
GKAFARHGNLKMHKITTHTEEKPYKCDQCGKGFAYHRSFQVHKRAHTGEKPYECKQCGKA
FACQNYYQVHKRTHTGEKPYECKECGKAFAYQHCYQIHKRIHTGEKPYECKQCGKAFAYQ
NYYQVHKRIHTGEKPYECKQCSISFAFLGQLRKHEKIHSGEKSY
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttggagacctacaggaacctcaatgctgtaggctacaattgggaagaccataatatt
gaagaacattgtcaaagttccagaagacatggaaggcatgaaagaagttttactggagag
aatccctatgaaggcattcagtgcggtgaagcctttgttcatcacaatagtctccgaatg
cagaaaataacacacactggagagaaatgctacaaatgcagtcaatgtgggaaagcctat
gcaggaccccatactctccaaatacatgaaagaacacatagtggagagaaagcctacgaa
tgtaatcaatgtactaaatcctttgcttctcatggtcaacttcgaaaacatgaaagaatt
catactcgagggaaatcttacaaatgtaatcaatgttgtaaagcctttgcataccctggt
aatcttcaaatgcataaaagaatgcatactgaacacaaaccctatgaatgtaatcaatgc
agtaaatcctttgcttctcatggtcaacttcgaatgcatgaaagaatacatactcgaggg
aaatcttacaaatgtaatcaatgttctaaagcctttgtataccctggtaatcttcgaatg
cataaaagaatgcatactgaacacaaactctatgaatgtaatcaatgtagtaaatccttt
gtttctcatggtcaacttcgaatacatgaaagaattcatactgaagagaaaccctatcaa
tgtaatcaatgtagtaaaacctttgtttgtcatggtcaacttcgaatacatgaaagaaca
catactagagagaaaccctatgaatgtaatcaatgtagtaaaacctttgcttctcatggt
caacttcaaatacatgaaagaattcatactggagagaaaccttacaaatgtgatcagtgt
ggcaaagcctttgcacgacacggtaatctcaaaatgcataaaataacaacacatactgaa
gagaaaccttacaagtgtgatcagtgtggtaaaggctttgcatatcatagaagtttccaa
gtacataaaagagcacatactggagagaagccctatgaatgtaagcaatgtggcaaagcc
tttgcatgtcaaaattattaccaagtacataaaagaacacatactggagagaaaccctat
gaatgcaaggaatgtggcaaagcctttgcatatcaacattgttaccaaatacataaaaga
atacatactggagagaaaccctatgaatgtaagcaatgtggcaaagcctttgcatatcaa
aattattaccaagtacataaaagaatacataccggagagaaaccctatgaatgtaagcaa
tgtagtatatcttttgcttttcttggtcaacttcgaaaacatgaaaaaattcatagtgga
gagaaaagttattaa

DBGET integrated database retrieval system