KEGG   Mus musculus (mouse): 100041759
Entry
100041759         CDS       T01002                                 

Gene name
Defa41, Gm15293
Definition
(RefSeq) defensin, alpha, 41
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041759 (Defa41)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041759 (Defa41)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041759 (Defa41)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 100041759
NCBI-ProteinID: NP_001170957
MGI: 3705230
Ensembl: ENSMUSG00000079116
Vega: OTTMUSG00000019786
UniProt: D3YX02
Position
8; 8 A2
AA seq 93 aa
MKTFVLLSALVLLAFQAQADPIHKTDEETNTEEQPGEEDQAVSISSGGQEGSALHEELSK
KLICYCRIRGCKRRECVFGTCRNLFLTFVFCCS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacatttgtcctcctctctgcccttgtcctgctggccttccaggcccaggctgat
cctatccacaaaacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctatctcctctggaggccaagaagggtctgctcttcatgaagaattgtcaaaa
aagctgatatgctattgtagaataagaggctgcaaaagaagagaatgcgtttttgggacc
tgcagaaatctttttttaactttcgtattctgttgcagctga

DBGET integrated database retrieval system