KEGG   Mus musculus (mouse): 100041787
Entry
100041787         CDS       T01002                                 

Symbol
Defa40, Gm15292
Name
(RefSeq) defensin, alpha, 40
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100041787 (Defa40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100041787 (Defa40)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100041787 (Defa40)
SSDB
Motif
Pfam: Defensin_propep Defensin_1 MF_alpha_N DUF3316
Other DBs
NCBI-GeneID: 100041787
NCBI-ProteinID: NP_001170958
MGI: 3708769
Ensembl: ENSMUSG00000074441
Vega: OTTMUSG00000019784
UniProt: L7N231
Position
8 A2; 8
AA seq 93 aa
MKTLVLLSALFLLAFQVQADPIQKTDEETNTEVQPEEEEQAMSVSFGNPEGSDLQEESLR
DLGCYCRKRGCTRRERINGTCRKGHLMYTLCCL
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttttcctgctggccttccaagtccaggctgat
cctatccaaaaaacagatgaagagactaatactgaggtgcagccagaggaagaggagcag
gctatgtctgtctcctttggaaatccagaaggctctgatcttcaagaagaatcgttgaga
gatctgggatgctattgtagaaaaagaggctgcacaagaagagaacgcattaatgggacc
tgcagaaagggtcatttaatgtacacactctgctgcctctga

DBGET integrated database retrieval system