KEGG   Mus musculus (mouse): 100041874Help
Entry
100041874         CDS       T01002                                 

Gene name
Gm3558
Definition
(RefSeq) predicted gene 3558
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Takusan DUF2674
Motif
Other DBs
NCBI-GeneID: 100041874
NCBI-ProteinID: NP_001257771
MGI: 3781735
Ensembl: ENSMUSG00000079364
Vega: OTTMUSG00000035723
UniProt: Q5FWC9
Position
14 A1; 14
AA seq 205 aa AA seqDB search
MFSWLLRLFQKENGDEGETRPTEKEEGILSHEKGRRKWFWRRHRSARNTSTQNSKMTKKR
SKINELEELKLDMRKISNDMEEMCGILNLYMYEDLNYRMNTEFNIIKSQHEKTMLDMNKM
IQSIIGSMQYSKELIEDNYSYSIKEDHLLRECTQLHENVRILLNENRRLLVEQAGHKCPV
GKKRGSLRRPARTSVPQVPRSSSVI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctggctgctcaggctatttcagaaagagaatggcgatgaaggagagaccaga
ccaacagagaaggaagagggaatcctttctcatgaaaaaggaagaaggaaatggttctgg
agaaggcacaggtctgctagaaatacttcaacccaaaattccaaaatgactaagaagaga
tcaaaaataaatgaactagaagaactgaaattggatatgaggaagatcagcaatgacatg
gaggaaatgtgtggaatcctgaacctttacatgtatgaggatttgaactacaggatgaac
actgaattcaacatcattaaatcacaacatgagaagacaatgttggatatgaataaaatg
atccagtccataattggttccatgcagtactccaaggaactgatagaagataactattcc
tacagcattaaggaggaccacctcctccgtgagtgcactcaactccacgaaaacgtaagg
atattactgaatgagaacagaaggctgctggtggagcaggctggccacaagtgtcctgtg
gggaagaaaagaggttctctgaggaggccagcaagaacatctgtgcctcaagtgccaagg
agcagcagtgtgatatag

DBGET integrated database retrieval system