KEGG   Mus musculus (mouse): 100041953Help
Entry
100041953         CDS       T01002                                 

Gene name
Sap18b, Gm10094
Definition
(RefSeq) Sin3-associated polypeptide 18B
  KO
K14324  histone deacetylase complex subunit SAP18
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
Module
mmu_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100041953 (Sap18b)
   03015 mRNA surveillance pathway
    100041953 (Sap18b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100041953 (Sap18b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     100041953 (Sap18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAP18
Motif
Other DBs
NCBI-GeneID: 100041953
NCBI-ProteinID: NP_001135913
MGI: 3704317
Ensembl: ENSMUSG00000061104
Vega: OTTMUSG00000061797
UniProt: E9Q317
Structure
PDB: 

Position
8; 8 D1
AA seq 172 aa AA seqDB search
MLAAGVGGQGERLPGRRRKMAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHH
RMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGY
RVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgcaggggtcggaggtcagggcgagcgtctcccgggccgaaggaggaagatg
gcggtggagtcgcgcgttacccaggaggaaattaagaaggagccggagaagccgatcgac
cgcgagaagacctgcccgctcctgctgcgggtcttcaccaccaacaacggccgccaccac
cgaatggacgagttctcccgcgggaacgtgccttcgagcgagctgcagatctacacctgg
atggatgcaaccttgaaagaactgactagtttagtgaaggaagtctacccagaagccaga
aagaagggcacacacttcaattttgcaattgtttttatggatcttaaaagacctggatat
cgagttaaggagattggcagcaccatgtctggcaggaagggcactgatgactccatgacc
ctgcagtcacagaagttccaaataggggattatctggacatagccatcacgcctccaaat
cgggcgccgccttcgtcagggaggatgagaccctactga

DBGET integrated database retrieval system