KEGG   Mus musculus (mouse): 100042555
Entry
100042555         CDS       T01002                                 

Gene name
Gm13305, Gm2002
Definition
(RefSeq) predicted gene 13305
  KO
K05056  interleukin 11 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100042555 (Gm13305)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100042555 (Gm13305)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100042555 (Gm13305)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    100042555 (Gm13305)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   100042555 (Gm13305)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 100042555
NCBI-ProteinID: NP_001092818
MGI: 3801997
Ensembl: ENSMUSG00000073876
Vega: OTTMUSG00000011351
UniProt: P70225
Position
4 A5; 4
AA seq 432 aa
MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWF
RDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSC
QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRC
VVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASW
TYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLD
HRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPG
IPNLQRTPENFS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgaccagggtcctggtggccgtggctacagccctggtg
tcttcctcctccccctgcccccaagcttggggtcctccaggggtccagtatggacaacct
ggcaggcccgtgatgctgtgctgccccggagtgagtgctgggactccagtgtcctggttt
cgggatggagattcaaggctgctccagggacctgactctgggttaggacacagactggtc
ttggcccaggtggacagccctgatgaaggcacttatgtctgccagaccctggatggtgta
tcagggggcatggtgaccctgaagctgggctttcccccagcacgtcctgaagtctcttgc
caagcggtagactatgaaaacttctcctgtacttggagtccaggccaggtcagcggtttg
cccacccgctaccttacttcctacaggaagaagacgctgccaggagctgagagtcagagg
gaaagtccatccaccgggccttggccgtgtccacaggaccctctggaggcctcccgatgt
gtggtccatggggcagagttctggagtgagtaccggatcaatgtgaccgaggtgaaccca
ctgggtgccagcacgtgcctactggatgtgagattacagagcatcttgcgtcccgatcca
ccccaaggactgcgggtggaatccgtacctggttacccaagacgcctgcatgccagctgg
acataccctgcctcctggcgtcgccaaccccactttctgctcaagttccggttgcaatac
cgaccagcacagcatccagcctggtccacggtggagcccattggcttggaggaagtgata
acagatactgtggctgggctgccccacgcggtacgagtcagtgccagggactttctggat
gctggcacctggagcgcctggagcccagaggcctggggtactcctagcactggtctcctg
caggatgagatacctgattggagccagggacatggacagcagctagaggcagtagtagct
caggaggacagcctggctcctgcaaggccttccttgcagccagacccaaggccacttgat
cacagggatcccttggagcaagtagctgtgttagcatctctgggaatcttctcttgcctt
ggcctggctgttggagccctggcactggggctctggctgaggctgagacggagtgggaag
gaaggaccgcaaaaacctgggctcttggcacccatgatcccggtggaaaagcttccagga
attccaaacctgcagaggaccccagagaacttcagctga

KEGG   Mus musculus (mouse): 12804
Entry
12804             CDS       T01002                                 

Gene name
Cntfr, Cntf, Cntfralpha
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12804 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12804 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12804 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    12804 (Cntfr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   12804 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  12804 (Cntfr)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 ig Ig_5
Other DBs
NCBI-GeneID: 12804
NCBI-ProteinID: NP_001129528
MGI: 99605
Ensembl: ENSMUSG00000028444
Vega: OTTMUSG00000006676
UniProt: O88507
Position
4 A5; 4 21.81 cM
AA seq 372 aa
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSILFLTSVPVTLVL
AAAAATANNLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgcttctgtcccatgggcctgctgtgctgtgcttgccgctgccgccgccgctgtc
tacacgcagaaacacagtccacaggaggcaccccacgtgcagtatgagcgtctgggcgca
gatgtgacgctgccgtgtgggacagcgagctgggacgcagctgtgacatggagggtaaac
gggacagatctggcccctgacctgctcaacggctctcagctgatactgcgaagcttagaa
ctgggccacagtggcctatacgcctgtttccaccgtgactcctggcacctgcgccaccaa
gtccttctacatgtgggtttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcacctgcccacccccacctacatccccaatacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcggtacatgcacctgttctcaaccatcaagtacaaggtctcc
ataagtgtcagcaacgccttgggtcacaacactacggccatcacctttgacgaattcacc
attgtgaagcctgatcctccagaaaacgtggtggcccggccagtgcccagcaacccccgt
cggctggaggtgacatggcagacaccctcaacttggcccgaccctgaatcctttcctctc
aagttcttcctgcgctaccggcctctcatcctggaccaatggcagcatgtggagctctcg
gatggcacagcacacaccatcacagatgcctacgcagggaaggaatacatcatccaggtg
gcagccaaggacaatgagattgggacatggagtgactggagcgtggctgctcacgccaca
ccctggactgaggaacctcggcatctcacaacagaagcccaggcccccgagaccacgacc
agcaccaccagctcattggcacccccacccaccacgaagatctgtgaccctggggagctt
ggcagcggcggaggaccctccatactcttcttgaccagtgtcccagtcactctggtcctg
gctgccgctgctgccacagccaacaatctcctgatctga

KEGG   Mus musculus (mouse): 12982
Entry
12982             CDS       T01002                                 

Gene name
Csf2ra, CD116, Csfg, Csfgmra, GM-CSF, GM-CSF-Ra, GM-CSFR
Definition
(RefSeq) colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12982 (Csf2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12982 (Csf2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12982 (Csf2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12982 (Csf2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12982 (Csf2ra)
   04090 CD molecules [BR:mmu04090]
    12982 (Csf2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12982 (Csf2ra)
CD molecules [BR:mmu04090]
 Proteins
  12982 (Csf2ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N fn3
Other DBs
NCBI-GeneID: 12982
NCBI-ProteinID: NP_034100
MGI: 1339754
Ensembl: ENSMUSG00000059326
UniProt: Q00941
Position
19 D3; 19 56.89 cM
AA seq 388 aa
MTSSHAMNITPLAQLALLFSTLLLPGTQALLAPTTPDAGSALNLTFDPWTRTLTWACDTA
AGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSF
VNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGD
DVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSH
CTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKV
RAGDTRMKHWGEWSPAHPLEAEDTRVPGALLYAVTACAVLLCALALGVTCRRFEVTRRLF
PPIPGIRDKVSDDVRVNPETLRKDLLQP
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacgtcatcacatgccatgaacatcacccccctggctcagctcgccctgctcttctcc
acgctactgcttccgggaactcaggcccttctggctccgaccacaccggacgccggctcc
gccctcaacctgaccttcgacccctggactcggacgctgacctgggcctgcgacaccgcc
gcggggaacgtcacggtgacgtcatgcaccgtgacctcgcgggaggcggggatacaccgg
cgagtctcgcccttcggttgccgctgctggttcaggaggatgatggcgctgcaccacggt
gtcacgctggatgtcaatggcacggtcgggggcgcggccgcgcactggaggctgagcttc
gtcaacgaaggcgcggcgggctcgggggcggagaacctgacctgcgagatccgagccgcg
cgcttcctttcctgcgcgtggcgggaggggccagcggcgcccgcggacgtccggtactcg
ctgcgagtcctcaactccacgggtcacgacgtggcgcgatgcatggccgaccccggggat
gacgtcatcacacagtgcattgcgaacgacttgtcactgctggggagtgaggcctacttg
gtcgtgaccggtcggagcggtgcggggccagtgcggttcctggacgacgtggtggctacg
aaggcgctcgagcgactcggtcccccacgtgacgtcaccgcgtcctgtaactcttcccac
tgcaccgtctcgtgggccccgccctcgacctgggcatccttgacggcccgggacttccag
tttgaggtccagtggcagagcgcagagccaggaagcacaccccggaaggtgctcgtcgtg
gaggagacccgcctcgccttccccagccccgccccccacggaggtcacaaggtcaaggtg
cgcgcgggcgacacgaggatgaagcactggggcgaatggagtcccgcccatcctctcgag
gctgaggacacgcgagtgcccggtgcgctcctgtatgcagtgacagcctgcgcagtccta
ctgtgcgcgctggcgctcggagtgacgtgcaggaggttcgaggtgacgcgccgactcttc
ccgcccatcccagggatcagggacaaggtgtccgacgacgtgcgagtgaaccctgagacc
ctcaggaaggacctcctgcagccctag

KEGG   Mus musculus (mouse): 12983
Entry
12983             CDS       T01002                                 

Gene name
Csf2rb, AI848964, AIC, AIC2B, Bc, CDw131, Csf2r, Csf2rb1, Csfgmrb, I, Il, Il3, Il3r, Il3rb, Il3rb1, Il5rb
Definition
(RefSeq) colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage)
  KO
K04738  cytokine receptor common subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12983 (Csf2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12983 (Csf2rb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12983 (Csf2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12983 (Csf2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12983 (Csf2rb)
   04090 CD molecules [BR:mmu04090]
    12983 (Csf2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12983 (Csf2rb)
CD molecules [BR:mmu04090]
 Proteins
  12983 (Csf2rb)
SSDB
Motif
Pfam: Tissue_fac IL6Ra-bind EpoR_lig-bind IL4Ra_N Interfer-bind fn3 Pur_ac_phosph_N IL2RB_N1 Comm LIFR_N
Other DBs
NCBI-GeneID: 12983
NCBI-ProteinID: NP_031806
MGI: 1339759
Ensembl: ENSMUSG00000071713
UniProt: P26955
Position
15 E1; 15 37.36 cM
AA seq 896 aa
MDQQMALTWGLCYMALVALCWGHGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGL
INMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDS
DLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKR
LQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDS
QPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPP
GASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSL
HWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKP
ISNYDGIWSKWSEEYTWKTDWVMPTLWIVLILVFLILTLLLILRFGCVSVYRTYRKWKEK
IPNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGESYAHLEDNNVSPL
TIEDPNIIRVPPSGPDTTPAASSESTEQLPNVQVEGPTPNRPRKQLPSFDFNGPYLGPPQ
SHSLPDLPDQLGSPQVGGSLKPALPGSLEYMCLPPGGQAQLVPLSQVMGQGQAMDVQCGS
SLETSGSPSVEPKENPPVELSMEEQEARDNPVTLPISSGGPEGSMMASDYVTPGDPVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAAKSPP
GHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PSLCSETEDLVQDLSVKKFPYQPMPQAPAIQFFKSLKHQDYLSLPPWDNSQSGKVC
NT seq 2691 nt   +upstreamnt  +downstreamnt
atggaccagcaaatggcactcacatgggggctgtgctacatggcactggtggctctctgt
tggggacacggggtgacagaggcagaagaaacggtccctctgaagactctgcagtgctac
aatgactacaccaaccacatcatctgcagctgggcggacacagaggatgcccaggggcta
atcaacatgaccctctatcaccagctagagaaaaaacagccagtgtcctgtgagctcagt
gaggaactcatgtggtcagagtgcccgtcatcccaccgctgtgtgcccagaagatgtgtc
atcccctatacacgattttccatcacaaacgaagactactactccttccggccagatagt
gatctgggcatccagctcatggtgccacttgcccagaatgtgcagccaccacttcccaag
aacgtcagcatcagctcctctgaggatcgtttcctgctggagtggagtgtgtcccttggg
gatgcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataagcgg
cttcaggactcctgggaggatgcctacagtctccacactagcaaatttcaggtgaatttc
gagccaaagctattcctacccaacagcatctatgctgcccgtgtgcgcactcggctgtcc
ccgggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggactcc
cagccaggggacaaggcccagccacagaaccttcaatgcttctttgatgggatccagtcc
ctccactgctcctgggaggtgtggacccagacgactggctctgtttcctttgggctcttc
tatcgccccagccctgtagctccggaggagaaatgctctccggtggtgaaggagccgccg
ggggccagtgtctacacccgctaccattgcagtctacctgtgcctgagcccagtgcacac
agccagtacacagtctctgttaagcacctggaacaagggaagttcatcatgagctataac
cacatccagatggagcctccaaccctcaacctgaccaagaacagagacagctacagcctg
cattgggaaactcagaagatggcttactcattcattgagcacacattccaggtccagtac
aagaagaaatcggacagctgggaggacagcaagacagagaacctagatcgagcccatagc
atggacctctcccagctggagccagacacctcatactgcgccagggtgagggtcaagccc
atctctaactacgatgggatctggagcaagtggagcgaagagtacacttggaagactgac
tgggtgatgcccacgctgtggatagtcctcatcctggtctttctcatcctcaccttgctc
ctgatccttcgctttggctgtgtctctgtatacaggacgtacaggaagtggaaggaaaag
atccccaaccccagcaagagcctcctgttccaggatggaggtaaaggtctctggcctcct
ggcagcatggcagccttcgccactaagaaccccgctctccaggggccacagagcaggctt
cttgctgagcaacagggggagtcatatgcacatttggaagacaacaacgtgtcacctctc
actatagaggaccctaatataattcgagttccaccatccgggcctgatacaaccccagct
gcctcatccgaatccacagagcaacttcccaatgttcaagtagagggaccaactcctaac
agacctaggaagcaattacccagctttgacttcaatgggccctacctggggcctccccaa
tcccactctctgcctgatctcccagaccagctgggttccccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggtcaagcgcaa
ctggttccattgtcccaggtgatggggcagggccaggctatggatgtgcagtgtgggtcc
agcctggagacctcagggagcccttctgtggagccaaaggagaaccctccagttgagctg
agcatggaggaacaggaggcacgggacaacccagtgactctgcccataagctctgggggc
cctgagggcagtatgatggcctctgattatgtcactcctggagatccggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctctagggccacca
gggtttgaggactatgtggagctgcctccaagtgtgagccaggctgccaagtcccctcca
ggccatcctgctcctcctgtggcaagcagccccacagtgatcccaggagagcccagggag
gaagtgggcccagcatccccacatcccgaaggcctccttgttcttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctct
ccaagtctgtgttctgagactgaggacctagtccaggacttgtctgtcaaaaagtttccc
tatcagcccatgccccaggcgccagccattcagtttttcaagtccctaaagcatcaggac
tacctgtccctgcccccttgggacaatagccagtctgggaaggtgtgctga

KEGG   Mus musculus (mouse): 12984
Entry
12984             CDS       T01002                                 

Gene name
Csf2rb2, AI, AIC2A, BetaIl3, Bi, Bil3, Csfgmrb, I, Il3, Il3r, Il3rb, Il3rb2
Definition
(RefSeq) colony stimulating factor 2 receptor, beta 2, low-affinity (granulocyte-macrophage)
  KO
K04738  cytokine receptor common subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12984 (Csf2rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12984 (Csf2rb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12984 (Csf2rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12984 (Csf2rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12984 (Csf2rb2)
   04090 CD molecules [BR:mmu04090]
    12984 (Csf2rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   12984 (Csf2rb2)
CD molecules [BR:mmu04090]
 Proteins
  12984 (Csf2rb2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind IL4Ra_N fn3 Interfer-bind IL2RB_N1 Pur_ac_phosph_N LIFR_N
Other DBs
NCBI-GeneID: 12984
NCBI-ProteinID: NP_031807
MGI: 1339760
Ensembl: ENSMUSG00000071714
UniProt: P26954
Structure
PDB: 
4QQV

Position
15 E1; 15 37.22 cM
AA seq 878 aa
MDQQMALTWGLCYMALVALCWGHEVTEEEETVPLKTLECYNDYTNRIICSWADTEDAQGL
INMTLLYHQLDKIQSVSCELSEKLMWSECPSSHRCVPRRCVIPYTRFSNGDNDYYSFQPD
RDLGIQLMVPLAQHVQPPPPKDIHISPSGDHFLLEWSVSLGDSQVSWLSSKDIEFEVAYK
RLQDSWEDASSLHTSNFQVNLEPKLFLPNSIYAARVRTRLSAGSSLSGRPSRWSPEVHWD
SQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPAAPEEKCSPVVKEP
QASVYTRYRCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYYHIQMEPPILNQTKNRDSYSL
HWETQKIPKYIDHTFQVQYKKKSESWKDSKTENLGRVNSMDLPQLEPDTSYCARVRVKPI
SDYDGIWSEWSNEYTWTTDWVMPTLWIVLILVFLIFTLLLALHFGRVYGYRTYRKWKEKI
PNPSKSLLFQDGGKGLWPPGSMAAFATKNPALQGPQSRLLAEQQGVSYEHLEDNNVSPLT
IEDPNIIRDPPSRPDTTPAASSESTEQLPNVQVEGPIPSSRPRKQLPSFDFNGPYLGPPQ
SHSLPDLPGQLGSPQVGGSLKPALPGSLEYMCLPPGGQVQLVPLSQVMGQGQAMDVQCGS
SLETTGSPSVEPKENPPVELSVEKQEARDNPMTLPISSGGPEGSMMASDYVTPGDPVLTL
PTGPLSTSLGPSLGLPSAQSPSLCLKLPRVPSGSPALGPPGFEDYVELPPSVSQAATSPP
GHPAPPVASSPTVIPGEPREEVGPASPHPEGLLVLQQVGDYCFLPGLGPGSLSPHSKPPS
PSLCSETEDLDQDLSVKKFPYQPLPQAPAIQFFKSLKY
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggaccagcaaatggcactcacatgggggctgtgctacatggcactggtggctctctgc
tggggacacgaggtgacagaggaagaagaaacggtccctctgaagactctggagtgctac
aatgactacaccaaccgtatcatctgcagctgggcagacacagaggatgcccaggggcta
atcaacatgaccctcctctatcaccagctagacaagattcaatcagtgtcctgtgagctc
agtgagaaactcatgtggtcagagtgcccgtcatcccaccgctgtgtgcccagaagatgt
gtcatcccctacacacgattttctaatggagataacgactactactccttccagccagat
cgtgacctgggcatccagctcatggtcccactggcccagcatgtgcagccaccccctccc
aaggacatccacatcagcccctctggggatcatttcctgctggaatggagtgtatctctt
ggggattcccaggtctcctggctttcatcaaaggacatagagtttgaggtggcttataag
cggcttcaggactcctgggaggatgcctccagtctccacactagcaactttcaggtgaat
ttagagccaaagctattcctacccaacagcatctatgctgcccgtgtgcgcactcggctg
tccgcgggttcaagcttgtctgggagacccagcagatggagcccagaggttcactgggac
tcccagccaggggacaaggcccagccacagaaccttcaatgcttctttgatgggatccag
tctctccactgctcctgggaggtgtggacccagacgactggctctgtttcctttgggctc
ttctatcgccccagccctgcagctccggaggagaaatgctctccggtggtgaaggagccg
caggccagcgtctacacccgctaccgctgcagtctacctgtgcctgagcccagtgcacac
agccagtacacagtctctgttaagcacctggaacaagggaagttcatcatgagctattac
cacatccagatggaacctccaatcctcaaccagaccaagaacagagacagctacagcctg
cattgggaaactcagaaaatacccaaatacattgatcacactttccaggtccagtacaag
aagaagtcagagagctggaaggacagcaagacagaaaacctaggtcgagtcaatagcatg
gacctgccccagctggagccggacacctcatactgcgccagggtgagggtcaagcccatc
tctgactacgacgggatctggagcgagtggagcaatgagtacacttggacgactgactgg
gtgatgcccacgctgtggatagtcctcatcctggtctttctcatcttcaccttgctcctg
gctctccactttggccgtgtttatgggtacaggacatacaggaagtggaaggaaaagatc
cccaaccccagcaagagcctcctgttccaggatggaggtaaaggtctctggcctcctggc
agcatggcagccttcgcgactaagaaccccgctctccaggggccacagagcaggcttctt
gctgagcaacagggggtgtcatatgaacatttggaagacaacaacgtgtcacctctcact
atagaggaccctaatataattcgagatccaccatccaggcctgatacaaccccagctgcc
tcatctgaatccacagagcaacttcccaatgttcaagtagagggaccaattccttctagc
cgacccaggaagcaattacccagctttgacttcaatgggccctacctggggcctccccaa
tcccactccctgcctgatctcccaggccagctgggttctccccaggtgggtgggagcctg
aagccagcactgccaggctccttggagtacatgtgtctgccccctggaggtcaagtgcaa
ctggtcccattgtcccaggtgatgggacagggccaggctatggatgtgcagtgtgggtcc
agcctggagaccacagggagcccttccgtggagccaaaggagaaccctccagttgagctg
agcgtggagaaacaggaggcaagggacaacccaatgactcttcccataagctctgggggc
cctgagggcagtatgatggcctctgattatgtcactcctggagatccggtgctcactctg
cccacagggcccctgtctacctctctgggcccctctctagggttgccctcagcccaaagc
cccagtctctgtcttaagctgcccagggtcccctctggaagcccagctctagggccacca
gggtttgaggactatgtggagctgcctccaagtgtgagccaggcagccacgtcccctcca
ggccatcctgctcctcctgtggcaagcagccccacagtgatcccaggagagcccagggag
gaagtgggcccagcatccccacatcccgaaggcctccttgttcttcagcaggttggggac
tactgcttcctccctggcctgggacctggctccctctcaccacacagtaagccaccctct
ccaagtctgtgttctgagactgaggacctagaccaggacttgtctgtgaaaaagtttccc
tatcaacccttgccccaggccccagccattcagtttttcaagtccctaaagtattag

KEGG   Mus musculus (mouse): 12986
Entry
12986             CDS       T01002                                 

Gene name
Csf3r, Cd114, Csf, Csfgr, G-CS, G-CSF-R, G-CSFR
Definition
(RefSeq) colony stimulating factor 3 receptor (granulocyte)
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12986 (Csf3r)
   04151 PI3K-Akt signaling pathway
    12986 (Csf3r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12986 (Csf3r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12986 (Csf3r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12986 (Csf3r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12986 (Csf3r)
   04090 CD molecules [BR:mmu04090]
    12986 (Csf3r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   12986 (Csf3r)
CD molecules [BR:mmu04090]
 Proteins
  12986 (Csf3r)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind ObR_Ig DUF3102
Other DBs
NCBI-GeneID: 12986
NCBI-ProteinID: NP_031808
MGI: 1339755
Ensembl: ENSMUSG00000028859
Vega: OTTMUSG00000009297
UniProt: P40223
Structure
PDB: 
1CD9 1PGR 1GCF 1CTO

Position
4 D2.2; 4 59.77 cM
AA seq 837 aa
MVGLGACTLTGVTLIFLLLPRSLESCGHIEISPPVVRLGDPVLASCTISPNCSKLDQQAK
ILWRLQDEPIQPGDRQHHLPDGTQESLITLPHLNYTQAFLFCLVPWEDSVQLLDQAELHA
GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVA
KKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGP
DVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQ
APVYTLQMRCIRSSLPGFWSPWSPGLQLRPTMKAPTIRLDTWCQKKQLDPGTVSVQLFWK
PTPLQEDSGQIQGYLLSWSSPDHQGQDIHLCNTTQLSCIFLLPSEAQNVTLVAYNKAGTS
SPTTVVFLENEGPAVTGLHAMAQDLNTIWVDWEAPSLLPQGYLIEWEMSSPSYNNSYKSW
MIEPNGNITGILLKDNINPFQLYRITVAPLYPGIVGPPVNVYTFAGERAPPHAPALHLKH
VGTTWAQLEWVPEAPRLGMIPLTHYTIFWADAGDHSFSVTLNISLHDFVLKHLEPASLYH
VYLMATSRAGSTNSTGLTLRTLDPSDLNIFLGILCLVLLSTTCVVTWLCCKRRGKTSFWS
DVPDPAHSSLSSWLPTIMTEETFQLPSFWDSSVPSITKITELEEDKKPTHWDSESSGNGS
LPALVQAYVLQGDPREISNQSQPPSRTGDQVLYGQVLESPTSPGVMQYIRSDSTQPLLGG
PTPSPKSYENIWFHSRPQETFVPQPPNQEDDCVFGPPFDFPLFQGLQVHGVEEQGGF
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggtagggctgggagcctgcaccctgactggagttaccctgatcttcttgctactcccc
agaagtctggagagctgtggacacatcgagatttcaccccctgttgtccgcctgggggac
cctgtcctggcctcttgcaccatcagcccaaactgcagcaaactggaccaacaggcaaag
atcttatggagactgcaagatgagcccatccaacctggggacagacagcatcatctgcct
gatgggacccaagagtccctcatcactctgcctcacttgaactacacccaggccttcctc
ttctgcttagtgccatgggaagacagcgtccaactcctggatcaagctgagcttcacgca
ggctatccccctgccagcccctcaaacctatcctgcctcatgcacctcaccaccaacagc
ctggtctgccagtgggagccaggtcctgagacccacctgcccaccagcttcatcctaaag
agcttcaggagccgcgccgactgtcagtaccaaggggacaccatcccggattgtgtggca
aagaagaggcagaacaactgctccatcccccgaaaaaacttgctcctgtaccagtatatg
gccatctgggtgcaagcagagaatatgctagggtccagcgagtccccaaagctgtgcctc
gaccccatggatgttgtgaaattggagcctcccatgctgcaggccctggacattggccct
gatgtagtctctcaccagcctggctgcctgtggctgagctggaagccatggaagcccagt
gagtacatggaacaggagtgtgaacttcgctaccagccacagctcaaaggagccaactgg
actctggtgttccacctgccttccagcaaggaccagtttgagctctgcgggctccatcag
gccccagtctacaccctacagatgcgatgcattcgctcatctctgcctggattctggagc
ccctggagccccggcctgcagctgaggcctaccatgaaggcccccaccatcagactggac
acgtggtgtcagaagaagcaactagatccagggacagtgagtgtgcagctgttctggaag
ccaacgcccctgcaggaagacagtggacagatccagggctacctgctgtcctggagttcc
ccagatcatcaagggcaggacatacacctttgcaacaccacgcagctcagctgtatcttc
ctcctgccctcagaggcccagaacgtgacccttgtggcctacaacaaagcagggacctct
tcacctactacagtggttttcctggagaacgaaggtccagctgtgaccggactccatgcc
atggcccaagaccttaacaccatctgggtagactgggaagcccccagccttctgcctcag
ggctatctcattgagtgggaaatgagttctcccagctacaataacagctataagtcctgg
atgatagaacctaacgggaacatcactggaattctgttaaaggacaacataaatcccttt
cagctctacagaattacagtggctcccctgtacccaggcatcgtgggacctcctgtaaat
gtctacaccttcgctggagagagagctcctcctcatgctccagcgctgcatctaaagcat
gttggcacaacctgggcacagctggagtgggtacctgaggcccctaggctggggatgata
cccctcacccactacaccatcttctgggccgatgctggggaccactccttctccgtcacc
ctgaacatctccctccatgactttgtcctgaagcacctggagcccgccagtttgtatcat
gtctacctcatggccaccagtcgggcagggtccaccaacagtacaggccttaccctgagg
accctagatccatctgacttaaacattttcctgggcatactttgcttagtactcttgtcc
actacctgtgtagtgacctggctctgctgcaaacgcagaggaaagacttccttctggtca
gatgtgccagacccagcccacagtagcctgagctcctggttgcccaccatcatgacagag
gaaaccttccagttacccagcttctgggactccagcgtgccatcaatcaccaagatcact
gaactggaggaagacaagaaaccgacccactgggattccgaaagctctgggaatggtagc
cttccagccctggttcaggcctatgtgctccaaggagatccaagagaaatttccaaccag
tcccagcctccctctcgcactggtgaccaggtcctctatggtcaggtgcttgagagcccc
accagcccaggagtaatgcagtacattcgctctgactccactcagcccctcttggggggc
cccacccctagccctaaatcttatgaaaacatctggttccattcaagaccccaggagacc
tttgtgccccaacctccaaaccaggaagatgactgtgtctttgggcctccatttgatttt
cccctctttcaggggctccaggtccatggagttgaagaacaagggggtttctag

KEGG   Mus musculus (mouse): 13649
Entry
13649             CDS       T01002                                 

Gene name
Egfr, 9030024J15Rik, AI552599, Erb, Erbb, Err, Errb1, Errp, Wa, Wa5, wa-2, wa2
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13649 (Egfr)
   04012 ErbB signaling pathway
    13649 (Egfr)
   04014 Ras signaling pathway
    13649 (Egfr)
   04015 Rap1 signaling pathway
    13649 (Egfr)
   04630 JAK-STAT signaling pathway
    13649 (Egfr)
   04066 HIF-1 signaling pathway
    13649 (Egfr)
   04068 FoxO signaling pathway
    13649 (Egfr)
   04020 Calcium signaling pathway
    13649 (Egfr)
   04072 Phospholipase D signaling pathway
    13649 (Egfr)
   04151 PI3K-Akt signaling pathway
    13649 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    13649 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13649 (Egfr)
   04520 Adherens junction
    13649 (Egfr)
   04540 Gap junction
    13649 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13649 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    13649 (Egfr)
   04915 Estrogen signaling pathway
    13649 (Egfr)
   04921 Oxytocin signaling pathway
    13649 (Egfr)
   04926 Relaxin signaling pathway
    13649 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    13649 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13649 (Egfr)
   05206 MicroRNAs in cancer
    13649 (Egfr)
   05205 Proteoglycans in cancer
    13649 (Egfr)
   05230 Central carbon metabolism in cancer
    13649 (Egfr)
   05231 Choline metabolism in cancer
    13649 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13649 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13649 (Egfr)
   05212 Pancreatic cancer
    13649 (Egfr)
   05225 Hepatocellular carcinoma
    13649 (Egfr)
   05226 Gastric cancer
    13649 (Egfr)
   05214 Glioma
    13649 (Egfr)
   05218 Melanoma
    13649 (Egfr)
   05219 Bladder cancer
    13649 (Egfr)
   05215 Prostate cancer
    13649 (Egfr)
   05213 Endometrial cancer
    13649 (Egfr)
   05224 Breast cancer
    13649 (Egfr)
   05223 Non-small cell lung cancer
    13649 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13649 (Egfr)
   05171 Coronavirus disease - COVID-19
    13649 (Egfr)
   05163 Human cytomegalovirus infection
    13649 (Egfr)
   05165 Human papillomavirus infection
    13649 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    13649 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13649 (Egfr)
   01522 Endocrine resistance
    13649 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13649 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13649 (Egfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13649 (Egfr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13649 (Egfr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13649 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   13649 (Egfr)
  Exosomal proteins of bladder cancer cells
   13649 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 13649
NCBI-ProteinID: NP_997538
MGI: 95294
Ensembl: ENSMUSG00000020122
Vega: OTTMUSG00000005185
UniProt: Q01279 Q9WVF5 Q9EP98 Q3TQS6
Position
11 A2; 11 9.41 cM
AA seq 1210 aa
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED
NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgttgctgaccgcgctctgcgcc
gcaggtggggcgttggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggat
actatccagtggagggacatcgtccaaaacgtctttatgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgctgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgctgcggggtgt
acagggccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgcccccgaaactacgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactacgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcttggcctgataactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtc
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcatttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccgtgaaccacgtctgcaatcctttatgctcctcggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccaggccatgaacatcacctgtacaggcaggggaccagacaactgcatc
cagtgtgcccactacattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggagagaacaacactctggtctggaagtatgcagatgccaataatgtctgccacctatgc
cacgccaactgtacctatggatgtgctgggccaggtcttcaaggatgtgaagtgtggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatgcgaagacgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactacgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgccgaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagtgatgtctgg
agctatggtgtcactgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
ccagcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacagcgctac
cttgttatccagggggatgaaagaatgcatttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacgtcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacgccttcttgcagcggtacagctccgaccccacaggtgctgtaacagaggac
aacatagatgacgcattcctccctgtacctgaatatgtaaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagtcaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatatttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

KEGG   Mus musculus (mouse): 13857
Entry
13857             CDS       T01002                                 

Gene name
Epor
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    13857 (Epor)
   04151 PI3K-Akt signaling pathway
    13857 (Epor)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13857 (Epor)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13857 (Epor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13857 (Epor)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    13857 (Epor)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   13857 (Epor)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 13857
NCBI-ProteinID: NP_034279
MGI: 95408
Ensembl: ENSMUSG00000006235
Vega: OTTMUSG00000062323
UniProt: P14753 Q3UTV9
Structure
PDB: 
2MXB

Position
9 A3; 9 7.93 cM
AA seq 507 aa
MDKLRVPLWPRVGPLCLLLAGAAWAPSPSLPDPKFESKAALLASRGSEELLCFTQRLEDL
VCFWEEAASSGMDFNYSFSYQLEGESRKSCSLHQAPTVRGSVRFWCSLPTADTSSFVPLE
LQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYE
VDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPAS
LLTASDLDPLILTLSLILVLISLLLTVLALLSHRRTLQQKIWPGIPSPESEFEGLFTTHK
GNFQLWLLQRDGCLWWSPGSSFPEDPPAHLEVLSEPRWAVTQAGDPGADDEGPLLEPVGS
EHAQDTYLVLDKWLLPRTPCSENLSGPGGSVDPVTMDEASETSSCPSDLASKPRPEGTSP
SSFEYTILDPSSQLLCPRALPPELPPTPPHLKYLYLVVSDSGISTDYSSGGSQGVHGDSS
DGPYSHPYENSLVPDSEPLHPGYVACS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggacaaactcagggtgcccctctggcctcgggtaggccccctctgtctcctacttgct
ggggcagcctgggcaccttcacccagcctcccggaccccaagtttgagagcaaagcggcc
ctgctggcatcccggggctccgaagaacttctgtgcttcacccaacgcttggaagacttg
gtgtgtttctgggaggaagcggcgagctccgggatggacttcaactacagcttctcatac
cagctcgagggtgagtcacgaaagtcatgtagcctgcaccaggctcccaccgtccgcggc
tccgtgcgtttctggtgttcactgccaacagcggacacatcgagttttgtgccgctggag
ctgcaggtgacggaggcgtccggttctcctcgctatcaccgcatcatccatatcaatgaa
gtagtgctcctggacgcccccgcggggctgctggcgcgccgggcagaagagggcagccac
gtggtgctgcgctggctgccacctcctggagcacctatgaccacccacatccgatatgaa
gtggacgtgtcggcaggcaaccgggcaggagggacacaaagggtggaggtcctggaaggc
cgcactgagtgtgttctgagcaacctgcggggcgggacgcgctacaccttcgctgttcga
gcgcgcatggccgagccgagcttcagcggattctggagtgcctggtctgagcccgcgtca
ctactgaccgctagcgacctggaccctctcatcttgacgctgtctctcattctggtcctc
atctcgctgttgctgacggttctggccctgctgtcccaccgccggactctgcagcagaag
atctggcctggcatcccaagcccagagagcgagtttgagggtctcttcaccacccacaag
ggtaacttccagctgtggctgctgcagcgtgatggttgtctgtggtggagcccgggcagc
tccttccctgaggatccacctgcccacctagaggtcctctcagagccacgctgggcagtg
actcaggctggggacccaggggcagatgatgaggggcccttactggagccggtgggcagt
gagcatgcccaggacacctacttggtattggataagtggttgctgccccggaccccatgc
agtgagaacctctcagggcctgggggcagtgtggaccctgtgactatggatgaagcttca
gaaacatcttcctgcccgtctgacttggcctcaaagcccaggccagagggcacctcacct
tccagctttgagtacaccatcctggaccccagctctcagctcctgtgccctcgggcactg
cctcccgagctacctcccactccacctcacttgaagtacctataccttgtggtgtccgat
tctggcatctcaacagattacagttcggggggctctcagggagtccacggggactcatct
gatggcccctactcccacccctatgagaacagccttgtcccagactcagagcctctgcat
cccggctatgtggcctgctcctag

KEGG   Mus musculus (mouse): 14600
Entry
14600             CDS       T01002                                 

Gene name
Ghr, GHB, GHBP, GHR/, GHR/BP
Definition
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    14600 (Ghr)
   04151 PI3K-Akt signaling pathway
    14600 (Ghr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14600 (Ghr)
   04060 Cytokine-cytokine receptor interaction
    14600 (Ghr)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    14600 (Ghr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    14600 (Ghr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   14600 (Ghr)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 Cna_B
Other DBs
NCBI-GeneID: 14600
NCBI-ProteinID: NP_001273299
MGI: 95708
Ensembl: ENSMUSG00000055737
Vega: OTTMUSG00000030599
UniProt: P16882 Q3UP14
Position
15 A1; 15 1.84 cM
AA seq 650 aa
MDLCQVFLTLALAVTSSTFSGSEATPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPE
LETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSC
YFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQ
VSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRS
RQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQFPWFLIIIFGIFGVAVMLFVVIFSKQQ
RIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFYNDDSWVEFIELDID
EADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTL
KFAQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEENKPQPLLSSETEATHQ
LASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIAQGNTQREVATPCQENYS
MNSAYFCESDAKKCIAVAPRMEATSCIKPSFNQEDIYITTESLTTTAQMSETADIAPDAE
MSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVSTDQLNKIMQ
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggatctttgtcaggtcttcttaaccttggcactggcagtcaccagcagcacattttct
ggaagtgaggctacaccagctactcttggcaaagcttccccagttctgcaaagaatcaat
ccaagcctggggacaagttcttctggaaagcctcgattcaccaagtgtcgttcccctgaa
ctggagacattttcatgctactggacagaaggagataatcctgatttaaagaccccagga
tctattcagctgtactatgctaaaagggaaagccaacgacaagctgcaagaattgctcat
gaatggacccaggaatggaaagaatgccctgattatgtctctgctggaaaaaacagctgt
tacttcaactcatcatatacctccatttggataccctactgcatcaagctaactacaaat
ggtgatttgctggaccaaaaatgtttcactgttgacgaaatagtgcaacctgatccaccc
attggcctcaactggactttactaaacattagtttgaccgggattcgtggagacatccaa
gtgagttggcaaccaccacccaatgcagatgttctgaagggatggataattctggagtat
gaaattcagtacaaagaagtaaatgaatcaaaatggaaagtgatgggccctatatggtta
acatactgtccagtgtactcattgagaatggataaagaacatgaagtgcgggtgagatcc
agacaacggagctttgaaaagtacagcgagttcagcgaagtcctccgtgtaatatttcct
cagacgaacatattggaagcatgtgaagaagatatccagtttccatggttcttaattatt
atctttggaatatttggagtagcagtgatgctatttgtagttatattttcaaagcagcaa
aggattaagatgctgattttacccccagtcccagttccaaagattaaagggattgatcca
gatcttctcaaggaagggaagttggaggaggtgaacaccatcttaggcattcatgataac
tacaaacccgacttctacaatgatgattcctgggtcgagttcattgagctagatattgat
gaagcagatgtggatgagaagactgaagggtctgacacagacagacttctaagcaatgat
catgagaaatcagctggtatccttggagcaaaggatgatgattctgggcgtaccagctgt
tacgaccctgacattttggatactgatttccataccagtgacatgtgtgatggtaccttg
aagtttgctcagtcacagaagttaaatatggaagctgatctcttgtgccttgatcagaag
aatctgaagaacttgccttatgatgcttcccttggctctctgcatccctccattacccag
acagtagaagaaaacaagccacagccacttttgagcagcgaaactgaggcaacccaccaa
ctcgcctctacaccgatgagtaatcccacatcactggcaaacattgacttttatgcccaa
gtaagcgacattacaccagcaggtggtgtagtcctttccccaggccaaaagattaaggca
gggatagcccaaggcaatacccagcgggaggtggccacgccctgccaagaaaattacagc
atgaacagtgcctacttttgtgagtcagatgccaaaaaatgcatcgctgtggcccctcgc
atggaagccacgtcttgtataaaaccaagctttaaccaagaggacatttacatcaccaca
gaaagccttaccactactgcccagatgtctgagacagcagatattgctccagatgctgag
atgtctgtcccagactacaccacggttcacaccgtgcagtctccaaggggccttatactc
aacgcaactgctttgcctttgcctgacaaaaagaattttccctcctcgtgtggttatgtg
agcacagaccaactgaacaaaatcatgcagtag

KEGG   Mus musculus (mouse): 15975
Entry
15975             CDS       T01002                                 

Gene name
Ifnar1, I, If, Ifar, Ifnar, Ifrc, Infar
Definition
(RefSeq) interferon (alpha and beta) receptor 1
  KO
K05130  interferon receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15975 (Ifnar1)
   04151 PI3K-Akt signaling pathway
    15975 (Ifnar1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15975 (Ifnar1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15975 (Ifnar1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15975 (Ifnar1)
   04621 NOD-like receptor signaling pathway
    15975 (Ifnar1)
   04650 Natural killer cell mediated cytotoxicity
    15975 (Ifnar1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15975 (Ifnar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15975 (Ifnar1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    15975 (Ifnar1)
   05160 Hepatitis C
    15975 (Ifnar1)
   05171 Coronavirus disease - COVID-19
    15975 (Ifnar1)
   05164 Influenza A
    15975 (Ifnar1)
   05162 Measles
    15975 (Ifnar1)
   05168 Herpes simplex virus 1 infection
    15975 (Ifnar1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15975 (Ifnar1)
   05169 Epstein-Barr virus infection
    15975 (Ifnar1)
   05165 Human papillomavirus infection
    15975 (Ifnar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15975 (Ifnar1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15975 (Ifnar1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 15975
NCBI-ProteinID: NP_034638
MGI: 107658
Ensembl: ENSMUSG00000022967
Vega: OTTMUSG00000027185
UniProt: P33896
Structure
PDB: 
3WCY

Position
16 C3.3; 16 52.98 cM
AA seq 590 aa
MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTF
SAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPF
IPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTI
NSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQ
GKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPIPTCANVQTTHCVFSQDTVY
TGTFFLHVQASEGNHTSFWSEEKFIDSQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDG
LNYEIIFWENTSNTKISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCE
KTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSK
NLVLLTAEEHTERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTE
SGQAVLSKAPCGGPCSVPSPPGTLEDGTCFLGNEKYLQSPALRTEPALLC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgctcgctgtcgtgggcgcggcggccctggtgctggtggccggggcgccttgggtgcta
ccctcagctgcaggtggagaaaatctgaaacctcctgagaatatagacgtctacattata
gatgacaactacaccctaaagtggagcagccacggagagtcaatgggcagtgtgaccttt
tcagcagaatatcgaacaaaagacgaggcgaagtggttaaaagtgcctgaatgtcaacat
actacaacgaccaagtgtgaattctctttactggacacaaatgtgtatatcaaaacacag
tttcgtgtcagagcagaggaagggaacagcacatcttcgtggaatgaggttgatccgttt
attccattctacacagctcacatgagccccccagaagtacgtttagaagctgaagataaa
gccatactagtccacatctctcctcccggacaagacgggaacatgtgggcactggagaaa
ccttccttcagttacaccatacgaatctggcagaagtcttccagtgacaaaaaaactatt
aactctacgtattatgtagaaaagataccagaactcttgccagagactacttactgttta
gaagttaaagcaatacatccgtcacttaagaaacacagcaattacagcactgtgcagtgt
ataagcaccacagtggcaaataaaatgcctgtgccaggaaatctccaagtggatgcccaa
ggcaagagctatgtcctgaaatgggactacattgcgtctgcagacgtgctcttcagggca
cagtggcttcctggctattcaaaaagcagttctggaagccgttcagataaatggaaacca
ataccaacctgtgcaaatgtccagactacgcactgtgtcttttctcaagatactgtctac
acaggaacgttctttctccatgtacaagcctcagagggaaatcacacatccttttggtct
gaagagaagtttattgattctcaaaaacacattctccctcctcctccggtcattactgtc
accgccatgagtgacaccttgcttgtttatgtcaactgtcaggacagcacatgtgatgga
ctcaattacgaaatcatcttttgggaaaacacttccaatactaagataagcatggagaag
gatggcccagagttcaccctcaagaacctgcagccgctgactgtgtactgtgtccaggcc
agagtgctcttcagggccctgctgaataagaccagcaacttcagtgaaaagctgtgtgag
aaaacacgtccaggaagtttttccacgatctggattataactggattaggtgttgtgttc
ttctctgtcatggtcctttatgctttgaggagcgtctggaaatacctgtgtcatgtgtgc
ttcccaccactcaagcctccccgcagtattgatgagtttttctctgagccgccttcaaaa
aaccttgtacttctgacggctgaggagcacacggaaagatgcttcatcattgagaataca
gacacggtcgctgtagaagtaaagcacgcgcctgaggaggacctcaggaagtacagctca
cagaccagccaggactcgggcaactattccaacgaagaggaggagagtgtgggcaccgag
agcggccaagctgtgctctccaaagctccctgcggggggccatgcagcgtgcctagccct
cctgggaccttggaagacgggacctgcttcctgggaaatgaaaaatatcttcagagccca
gccctgaggacagagccagctcttctctgctga

KEGG   Mus musculus (mouse): 15976
Entry
15976             CDS       T01002                                 

Gene name
Ifnar2, AI747302, Ifn, Ifnar-2
Definition
(RefSeq) interferon (alpha and beta) receptor 2
  KO
K05131  interferon receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15976 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    15976 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15976 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15976 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15976 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    15976 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    15976 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15976 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15976 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    15976 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    15976 (Ifnar2)
   05164 Influenza A
    15976 (Ifnar2)
   05162 Measles
    15976 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    15976 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15976 (Ifnar2)
   05169 Epstein-Barr virus infection
    15976 (Ifnar2)
   05165 Human papillomavirus infection
    15976 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15976 (Ifnar2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15976 (Ifnar2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac IL6Ra-bind
Other DBs
NCBI-GeneID: 15976
NCBI-ProteinID: NP_034639
MGI: 1098243
Ensembl: ENSMUSG00000022971
Vega: OTTMUSG00000040135
UniProt: O35664
Position
16 C3.3; 16 52.82 cM
AA seq 513 aa
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKS
GPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTV
CRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDS
VRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSE
SAIVGITTSCLVVMVFVSTIVMLKRIGYICLKDNLPNVLNFRHFLTWIIPERSPSEAIDR
LEIIPTNKKKRLWNYDYEDGSDSDEEVPTASVTGYTMHGLTGKPLQQTSDTSASPEDPLH
EEDSGAEESDEAGAGAGAEPELPTEAGAGPSEDPTGPYERRKSVLEDSFPREDNSSMDEP
GDNIIFNVNLNSVFLRVLHDEDASETLSLEEDTILLDEGPQRTESDLRIAGGDRTQPPLP
SLPSQDLWTEDGSSEKSDTSDSDADVGDGYIMR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcgttcacggtgcaccgtctctgccgtcggtctcctcagcttgtgtcttgtggtgtct
gcgagcctagagactatcacaccgtctgcttttgatgggtatccagatgaaccttgcact
ataaacataacaatacgaaattcccggctaattttatcctgggaattagagaacaagtct
ggcccacccgctaactacaccctctggtacacagtcatgagcaaagacgaaaatctgacg
aaggttaagaactgttcagataccacgaagtcatcatgtgacgtgacagataagtggttg
gagggcatggagagctacgtcgtcgccatcgtcatagtgcacagaggggacttgaccgtg
tgccgctgctcagactacatcgtgcctgcaaacgctcctcttgagccgccagaatttgag
atcgttggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaaa
ataatccaggaaaagatgaagactacaccctttgtcatcaaagaacagataggggacagc
gttaggaagaagcacgagcccaaagtgaataatgtcactgggaacttcacatttgtcctt
agagacttacttccaaagacaaactactgtgtatctctttattttgatgatgaccccgca
ataaaatctcccttaaaatgcatcgtccttcagcctggccaggaatcaggattatcagaa
tctgctatagtaggaataactacttcgtgtttggtagtgatggttttcgtgagcactatc
gtaatgctgaaacggattggttatatatgcctaaaagacaatttgcccaatgtcttgaac
ttccgccactttttaacctggataatccctgaacggtcaccttcagaagccatcgatcgg
ctggaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggc
agtgacagtgacgaagaggtccccacagcaagtgtcactggctacaccatgcatggactg
acgggcaagcctctgcaacaaacctctgacacctcagccagccccgaggatcccctgcat
gaagaagattcaggcgctgaggaatctgatgaagctggagcaggggctggagctgagcca
gaactccccacagaggcgggggcggggccttcagaagaccccactggcccctatgagaga
agaaagagtgtgctcgaggactcattccccagggaggacaacagctccatggatgagcct
ggggacaacattatcttcaacgtgaacttaaactctgtgtttctgagggttctccatgat
gaagatgcctcagagacattatctctcgaagaagacaccatcctcctagacgaaggtccc
cagaggacagagtcagaccttcggatagctggtggggacaggacacagccgcccctcccc
agccttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctca
gattccgatgctgatgtgggggacggctacatcatgagatga

KEGG   Mus musculus (mouse): 15979
Entry
15979             CDS       T01002                                 

Gene name
Ifngr1, CD119, IFN-g, IFN-gammaR, If, Ifgr, Ifngr, Nk, Nktar
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15979 (Ifngr1)
   04066 HIF-1 signaling pathway
    15979 (Ifngr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15979 (Ifngr1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15979 (Ifngr1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15979 (Ifngr1)
   04658 Th1 and Th2 cell differentiation
    15979 (Ifngr1)
   04659 Th17 cell differentiation
    15979 (Ifngr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15979 (Ifngr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15979 (Ifngr1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15979 (Ifngr1)
  09172 Infectious disease: viral
   05164 Influenza A
    15979 (Ifngr1)
   05168 Herpes simplex virus 1 infection
    15979 (Ifngr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15979 (Ifngr1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15979 (Ifngr1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15979 (Ifngr1)
   05140 Leishmaniasis
    15979 (Ifngr1)
   05142 Chagas disease
    15979 (Ifngr1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    15979 (Ifngr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15979 (Ifngr1)
   04090 CD molecules [BR:mmu04090]
    15979 (Ifngr1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15979 (Ifngr1)
CD molecules [BR:mmu04090]
 Proteins
  15979 (Ifngr1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind Cation_efflux
Other DBs
NCBI-GeneID: 15979
NCBI-ProteinID: NP_034641
MGI: 107655
Ensembl: ENSMUSG00000020009
Vega: OTTMUSG00000035345
UniProt: P15261
Position
10 A3; 10 8.49 cM
AA seq 477 aa
MGPQAAAGRMILLVVLMLSAKVGSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQ
NMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYA
RSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYT
VYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSK
DVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKS
ATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAG
GSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLP
NNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggcccgcaggcggcagctggcaggatgattctgctggtggtcctgatgctgtctgcg
aaggtcgggagtggagctttgacgagcactgaggatcctgagcctccctcggtgcctgta
ccgacgaatgttctaattaagtcttataacttgaaccctgtcgtatgctgggaataccag
aacatgtcacagactcctatttttactgtacaggtaaaggtgtattcgggttcctggact
gattcctgcaccaacatttctgatcattgttgtaatatctatgaacaaattatgtatcct
gatgtatctgcctgggccagagttaaagctaaggttggacaaaaagaatctgactatgca
cggtcaaaagagttccttatgtgcctaaagggaaaggtcgggccccctggcctggagatc
aggaggaagaaggaagaacagctctccgtcctcgtatttcaccctgaagtcgttgtgaat
ggagagagccagggaaccatgtttggtgacgggagcacctgttacacattcgactatact
gtgtatgtggagcataaccggagtggggagatcctacatacgaaacatacggtcgaaaaa
gaagagtgtaatgagactctgtgtgagttaaacatctcagtatccacactggattccaga
tattgtatttcagtagacggaatctcatctttctggcaagttagaacagaaaaatcgaaa
gacgtctgtatccctcctttccatgatgacagaaaggattcaatttggattctggtggtt
gctcctcttaccgtctttacagtagttatcctggtatttgcgtattggtatactaagaag
aattcattcaagagaaaaagcataatgttacctaagtccttgctctctgtggtaaaaagt
gccacgttagagacaaaacctgaatcgaagtattcacttgtcacaccgcaccagccagct
gtcctagagagtgagacggtgatctgtgaagagcccctgtccacagtgacagctccagac
agccccgaagcagcagaacaggaagaactttcaaaagaaacaaaggctctggaggctgga
ggaagcacgtctgccatgaccccagacagccctccaactccgacacaaagacgcagcttt
tccctgttaagtagtaaccagtcaggcccttgtagcctcaccgcctatcactcccgaaac
ggctctgacagtggcctcgtgggatcgggcagctccatatcggacttggaatctctccca
aacaacaactcagaaacaaagatggcagagcacgaccctccacccgtgagaaaggccccc
atggcctccggttatgacaaaccgcacatgttggtggacgtgcttgtggatgttgggggg
aaggagtctctcatggggtatagactcacaggagaggcccaggagctgtcctaa

KEGG   Mus musculus (mouse): 15980
Entry
15980             CDS       T01002                                 

Gene name
Ifngr2, Ifg, Ifgr2, Ifgt
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15980 (Ifngr2)
   04066 HIF-1 signaling pathway
    15980 (Ifngr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15980 (Ifngr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15980 (Ifngr2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15980 (Ifngr2)
   04658 Th1 and Th2 cell differentiation
    15980 (Ifngr2)
   04659 Th17 cell differentiation
    15980 (Ifngr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15980 (Ifngr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15980 (Ifngr2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    15980 (Ifngr2)
  09172 Infectious disease: viral
   05164 Influenza A
    15980 (Ifngr2)
   05168 Herpes simplex virus 1 infection
    15980 (Ifngr2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15980 (Ifngr2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    15980 (Ifngr2)
   05140 Leishmaniasis
    15980 (Ifngr2)
   05142 Chagas disease
    15980 (Ifngr2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    15980 (Ifngr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    15980 (Ifngr2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IFN receptor family
   15980 (Ifngr2)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 15980
NCBI-ProteinID: NP_032364
MGI: 107654
Ensembl: ENSMUSG00000022965
Vega: OTTMUSG00000028337
UniProt: Q63953
Position
16 C3.3; 16 53.07 cM
AA seq 332 aa
MRPLPLWLPSLLLCGLGAAASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPV
VYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSK
WVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQ
EQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARL
QQVILIPLGIFALLLGLTGACFTLFLKYQSRVKYWFQAPPNIPEQIEEYLKDPDQFILEV
LDKDGSPKEDSWDSVSIISSPEKERDDVLQTP
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcggcctttgccactgtggctgccgtcgctgctgctctgtgggctcggtgccgcggcg
tcctcgccagactcgttttcccagcttgcggcccctctgaacccaaggcttcacctgtac
aatgatgagcagattctaacttgggagccgtcaccttccagcaatgacccaagaccagtg
gtctaccaggtggaatatagcttcatcgatggctcttggcataggttgctggagccgaac
tgtacggacatcacagagacaaagtgtgacttaacaggaggcggccgcttgaagcttttc
ccacacccattcacagtcttcctgcgggtgcgagccaagcgagggaacctcacttccaag
tgggtggggctggagccatttcaacactatgagaatgttactgttggacctccgaaaaac
atctcggtgaccccaggaaaaggttccctcgtcatacacttctcccctccctttgatgtg
ttccacggggcaacttttcagtatcttgtccactactgggaaaagtcagaaacccaacag
gaacaggttgaaggccctttcaagagcaactccattgtgctgggcaatctgaagccatac
agagtatattgtttacaaactgaggcacaactgattttgaaaaacaaaaaaatccgacca
catgggctcttgagcaatgtatcctgtcacgaaacaacagcaaatgcctccgccaggctg
cagcaagtcatcctgattccgttgggcatcttcgcattgctgctcggcctgacgggcgcc
tgcttcaccctgttcctcaaataccaaagccgagtgaagtactggtttcaggctccgcca
aacatcccggaacaaatcgaagagtatctaaaggacccagaccaattcatcttagaggtc
ttggacaaggacggttcaccgaaggaggactcctgggactccgtgtcaattatttcttct
ccagaaaaggagcgagatgatgtgctccaaacaccgtga

KEGG   Mus musculus (mouse): 16154
Entry
16154             CDS       T01002                                 

Gene name
Il10ra, AW553859, CDw210, CDw210a, IL-10R1, IL-10RA, Il, Il10r, mIL-, mIL-10R
Definition
(RefSeq) interleukin 10 receptor, alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16154 (Il10ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16154 (Il10ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16154 (Il10ra)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16154 (Il10ra)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16154 (Il10ra)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16154 (Il10ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16154 (Il10ra)
   04090 CD molecules [BR:mmu04090]
    16154 (Il10ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   16154 (Il10ra)
CD molecules [BR:mmu04090]
 Proteins
  16154 (Il10ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 16154
NCBI-ProteinID: NP_032374
MGI: 96538
Ensembl: ENSMUSG00000032089
Vega: OTTMUSG00000042168
UniProt: Q61727 Q3UDL4 Q3UDV8
Position
9 A5.2; 9 24.84 cM
AA seq 575 aa
MLSRLLPFLVTISSLSLEFIAYGTELPSPSYVWFEARFFQHILHWKPIPNQSESTYYEVA
LKQYGNSTWNDIHICRKAQALSCDLTTFTLDLYHRSYGYRARVRAVDNSQYSNWTTTETR
FTVDEVILTVDSVTLKAMDGIIYGTIHPPRPTITPAGDEYEQVFKDLRVYKISIRKFSEL
KNATKRVKQETFTLTVPIGVRKFCVKVLPRLESRINKAEWSEEQCLLITTEQYFTVTNLS
ILVISMLLFCGILVCLVLQWYIRHPGKLPTVLVFKKPHDFFPANPLCPETPDAIHIVDLE
VFPKVSLELRDSVLHGSTDSGFGSGKPSLQTEESQFLLPGSHPQIQGTLGKEESPGLQAT
CGDNTDSGICLQEPGLHSSMGPAWKQQLGYTHQDQDDSDVNLVQNSPGQPKYTQDASALG
HVCLLEPKAPEEKDQVMVTFQGYQKQTRWKAEAAGPAECLDEEIPLTDAFDPELGVHLQD
DLAWPPPALAAGYLKQESQGMASAPPGTPSRQWNQLTEEWSLLGVVSCEDLSIESWRFAH
KLDPLDCGAAPGGLLDSLGSNLVTLPLISSLQVEE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgttgtcgcgtttgctcccattcctcgtcacgatctccagcctgagcctagaattcatt
gcatacgggacagaactgccaagcccttcctatgtgtggtttgaagccagatttttccag
cacatcctccactggaaacctatcccaaaccagtctgagagcacctactatgaagtggcc
ctcaaacagtacggaaactcaacctggaatgacatccatatctgtagaaaggctcaggca
ttgtcctgtgatctcacaacgttcaccctggatctgtatcaccgaagctatggctaccgg
gccagagtccgggcagtggacaacagtcagtactccaactggaccaccactgagactcgc
ttcacagtggatgaagtgattctgacagtggatagcgtgactctgaaagcaatggacggc
atcatctatgggacaatccatccccccaggcccacgataacccctgcaggggatgagtac
gaacaagtcttcaaggatctccgagtttacaagatttccatccggaagttctcagaacta
aagaatgcaaccaagagagtgaaacaggaaaccttcaccctcacggtccccataggggtg
agaaagttttgtgtcaaggtgctgccccgcttggaatcccgaattaacaaggcagagtgg
tcggaggagcagtgtttacttatcacgacggagcagtatttcactgtgaccaacctgagc
atcttagtcatatctatgctgctattctgtggaatcctggtctgtctggttctccagtgg
tacatccggcacccggggaagttgcctacagtcctggtcttcaagaagcctcacgacttc
ttcccagccaaccctctctgcccagaaactcccgatgccattcacatcgtggacctggag
gttttcccaaaggtgtcactagagctgagagactcagtcctgcatggcagcaccgacagt
ggctttggcagtggtaaaccatcacttcagactgaagagtcccaattcctcctccctggc
tcccacccccagatacaggggactctgggaaaagaagagtctccagggctacaggccacc
tgtggggacaacacggacagtgggatctgcctgcaggagcccggcttacactccagcatg
gggcccgcctggaagcagcagcttggatatacccatcaggaccaggatgacagtgacgtt
aacctagtccagaactctccagggcagcctaagtacacacaggatgcatctgccttgggc
catgtctgtctcctagaacctaaagcccctgaggagaaagaccaagtcatggtgacattc
cagggctaccagaaacagaccagatggaaggcagaggcagcaggcccagcagaatgcttg
gacgaagagattcccttgacagatgcctttgatcctgaacttggggtacacctgcaggat
gatttggcttggcctccaccagctctggccgcaggttatttgaaacaggagtctcaaggg
atggcttctgctccaccagggacaccaagtagacagtggaatcaactgaccgaagagtgg
tcactcctgggtgtggttagctgtgaagatctaagcatagaaagttggaggtttgcccat
aaacttgaccctctggactgtggggcagcccctggtggcctcctggatagccttggctct
aacctggtcaccctgccgttgatctccagcctgcaggtagaagaatga

KEGG   Mus musculus (mouse): 16155
Entry
16155             CDS       T01002                                 

Gene name
Il10rb, 6620401D04Rik, AI528744, CRF2-, CRF2-4, Crfb, Crfb4, D16H21S5, D16H21S58, D21S58, D21S58h, IL-10R2, Il1, Il10r2
Definition
(RefSeq) interleukin 10 receptor, beta
  KO
K05135  interleukin 10 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16155 (Il10rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16155 (Il10rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16155 (Il10rb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16155 (Il10rb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16155 (Il10rb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16155 (Il10rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16155 (Il10rb)
   04090 CD molecules [BR:mmu04090]
    16155 (Il10rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   16155 (Il10rb)
CD molecules [BR:mmu04090]
 Proteins
  16155 (Il10rb)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 Pur_ac_phosph_N DUF3139 zf-MIZ HemY_N
Other DBs
NCBI-GeneID: 16155
NCBI-ProteinID: NP_032375
MGI: 109380
Ensembl: ENSMUSG00000022969
Vega: OTTMUSG00000028329
UniProt: Q8VHM7
Position
16 C3.3; 16 52.87 cM
AA seq 351 aa
MSWAPSVAGWLGGFLLVPALGMIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYES
YRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEM
QIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVL
RNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPSWIVAIILIVSVLVVFLFL
LGCFVVLWLIYKKTKHTFRSGTSLPQHLKEFLGHPHHSTFLLFSFPPPEEAEVFDKLSII
SEESEGSKQSPEDNCASEPPSDPGPRELESKDEAPSPPHDDPKLLTSTSEV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtcctgggcgccgagcgtggcgggctggctgggtggcttccttctggtgccagctcta
ggaatgattccaccccctgagaaggtcagaatgaattcagttaatttcaagaacattcta
cagtgggaggtacctgctttccccaaaacgaacctgactttcacagctcagtatgaaagt
tacaggtctttccaagatcactgcaagcgcactgcctcgactcagtgcgacttctctcat
ctttctaaatacggagactacactgtgagagtcagggctgaattggcggatgaacattcg
gagtgggtcaatgtcaccttctgccccgtggaagacaccatcattggacctcctgagatg
cagatagaatcccttgctgagtctttacacctgcgtttctcagccccacaaattgagaat
gagcctgagacgtggaccttgaagaacatttatgactcatgggcttacagagtgcaatac
tggaaaaatgggactaatgagaagtttcaagttgtgtctccgtacgactctgaggtcctc
cggaacctggagccgtggacaacttactgcattcaagttcaagggtttcttctcgaccag
aacagaacaggagagtggagtgaacccatctgtgaacggacaggcaatgacgaaataacc
ccttcctggattgtggccatcatcctcatagtctccgtcctggtggtcttcctcttcctc
ctgggctgctttgtcgtgctgtggctcatttataagaagaccaagcataccttccgttct
gggacgtctcttccacagcacctgaaggagtttctgggccacccccatcacagcacgttt
ctgctgttctccttccctccccccgaggaggccgaggtgttcgacaaactaagcatcatc
agcgaagagtctgaaggcagcaagcagagtcctgaagacaactgtgcctcagagcccccg
tctgatccagggcctcgggagctggagtccaaggatgaagctccctcacctccacacgat
gaccccaaactgctcacgtcgacctcagaagtatga

KEGG   Mus musculus (mouse): 16157
Entry
16157             CDS       T01002                                 

Gene name
Il11ra1, AI314697, GP130, Il, Il-, Il-11ra, Il11ra, Il11ra2, N, NR1
Definition
(RefSeq) interleukin 11 receptor, alpha chain 1
  KO
K05056  interleukin 11 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16157 (Il11ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16157 (Il11ra1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16157 (Il11ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16157 (Il11ra1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16157 (Il11ra1)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 16157
NCBI-ProteinID: NP_001156873
MGI: 107426
Ensembl: ENSMUSG00000073889
Vega: OTTMUSG00000006681
UniProt: Q64385 Q3UIV4
Position
4 A5; 4 21.94 cM
AA seq 432 aa
MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWF
RDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSC
QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRC
VVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASW
TYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHGQQLEAVVAQEDSPAPARPSLQPDPRPLD
HRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKDGPQKPGLLAPMIPVEKLPG
IPNLQRTPENFS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgaccagggtcctggtggccgtggctacagccctggtg
tcttcctcctccccctgcccccaagcttggggtcctccaggggtccagtatggacaacct
ggcaggcccgtgatgctgtgctgccccggagtgagtgctgggactccagtgtcctggttt
cgggatggagattcaaggctgctccagggacctgactctgggttaggacacagactggtc
ttggcccaggtggacagccctgatgaaggcacttatgtctgccagaccctggatggtgta
tcagggggcatggtgaccctgaagctgggctttcccccagcacgtcctgaagtctcctgc
caagcggtagactatgaaaacttctcctgtacttggagtccaggccaggtcagcggtttg
cccacccgctaccttacttcctacaggaagaagacgctgccaggagctgagagtcagagg
gaaagtccatccaccgggccttggccgtgtccacaggaccctctggaggcctcccgatgt
gtggtccatggggcagagttctggagtgagtaccggatcaatgtgaccgaggtgaaccca
ctgggtgccagcacgtgcctactggatgtgagattacagagcatcttgcgtcctgatcca
ccccaaggactgcgggtggaatccgtacctggttacccgagacgcctgcatgccagctgg
acataccctgcctcctggcgtcgccaaccccactttctgctcaagttccggttgcaatac
cgaccagcacagcatccagcctggtccacggtggagcccattggcttggaggaagtgata
acagatgctgtggctgggctgccacacgcggtacgagtcagtgccagggactttctggat
gctggcacctggagcgcctggagcccagaggcctggggtactcctagcactggtcccctg
caggatgagatacctgattggagccagggacacggacagcagctagaggcagtagtagct
caggaggacagcccggctcctgcaaggccttccttgcagccggacccaaggccacttgat
cacagggaccccttggagcaagtagctgtgttagcgtctctgggaatcttctcttgcctt
ggcctggctgttggagctctggcactggggctctggctgaggctgagacggagtgggaag
gatggaccgcaaaaacctgggctcttggcacccatgatcccggtggaaaagcttccagga
attccaaacctgcagaggaccccagagaacttcagctga

KEGG   Mus musculus (mouse): 16158
Entry
16158             CDS       T01002                                 

Gene name
Il11ra2, Etl, Etl-, Etl-2, Etl2, Il11, Il11ra-ps1
Definition
(RefSeq) interleukin 11 receptor, alpha chain 2
  KO
K05056  interleukin 11 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16158 (Il11ra2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16158 (Il11ra2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16158 (Il11ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16158 (Il11ra2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16158 (Il11ra2)
SSDB
Motif
Pfam: Ig_3 ig EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 16158
NCBI-ProteinID: NP_034680
MGI: 109123
Ensembl: ENSMUSG00000078735
UniProt: P70225
Position
4 A5; 4 22.73 cM
AA seq 432 aa
MSSSCSGLTRVLVAVATALVSSSSPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWF
RDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSC
QAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRC
VVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASW
TYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDTVAGLPHAVRVSARDFLD
AGTWSAWSPEAWGTPSTGLLQDEIPDWSQGHGQQLEAVVAQEDSLAPARPSLQPDPRPLD
HRDPLEQVAVLASLGIFSCLGLAVGALALGLWLRLRRSGKEGPQKPGLLAPMIPVEKLPG
IPNLQRTPENFS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgaccagggtcctggtggccgtggctacagccctggtg
tcttcctcctccccctgcccccaagcttggggtcctccaggggtccagtatggacaacct
ggcaggcccgtgatgctgtgctgccccggagtgagtgctgggactccagtgtcctggttt
cgggatggagattcaaggctgctccagggacctgactctgggttaggacacagactggtc
ttggcccaggtggacagccctgatgaaggcacttatgtctgccagaccctggatggtgta
tcagggggcatggtgaccctgaagctgggctttcccccagcacgtcctgaagtctcttgc
caagcggtagactatgaaaacttctcctgtacttggagtccaggccaggtcagcggtttg
cccacccgctaccttacttcctacaggaagaagacgctgccaggagctgagagtcagagg
gaaagtccatccaccgggccttggccgtgtccacaggaccctctggaggcctcccgatgt
gtggtccatggggcagagttctggagtgagtaccggatcaatgtgaccgaggtgaaccca
ctgggtgccagcacgtgcctactggatgtgagattacagagcatcttgcgtcccgatcca
ccccaaggactgcgggtggaatccgtacctggttacccaagacgcctgcatgccagctgg
acataccctgcctcctggcgtcgccaaccccactttctgctcaagttccggttgcaatac
cgaccagcacagcatccagcctggtccacggtggagcccattggcttggaggaagtgata
acagatactgtggctgggctgccccacgcggtacgagtcagtgccagggactttctggat
gctggcacctggagcgcctggagcccagaggcctggggtactcctagcactggtctcctg
caggatgagatacctgattggagccagggacatggacagcagctagaggcagtagtagct
caggaggacagcctggctcctgcaaggccttccttgcagccagacccaaggccacttgat
cacagggatcccttggagcaagtagctgtgttagcatctctgggaatcttctcttgcctt
ggcctggctgttggagccctggcactggggctctggctgaggctgagacggagtgggaag
gaaggaccgcaaaaacctgggctcttggcacccatgatcccggtggaaaagcttccagga
attccaaacctgcagaggaccccagagaacttcagctga

KEGG   Mus musculus (mouse): 16161
Entry
16161             CDS       T01002                                 

Gene name
Il12rb1, CD212, IL-12R, IL-12R[b]
Definition
(RefSeq) interleukin 12 receptor, beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16161 (Il12rb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16161 (Il12rb1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16161 (Il12rb1)
   04659 Th17 cell differentiation
    16161 (Il12rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16161 (Il12rb1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16161 (Il12rb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16161 (Il12rb1)
   04090 CD molecules [BR:mmu04090]
    16161 (Il12rb1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16161 (Il12rb1)
CD molecules [BR:mmu04090]
 Proteins
  16161 (Il12rb1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 16161
NCBI-ProteinID: NP_032379
MGI: 104579
Ensembl: ENSMUSG00000000791
Vega: OTTMUSG00000061579
UniProt: Q60837
Position
8 B3.3; 8 34.21 cM
AA seq 738 aa
MDMMGLAGTSKHITFLLLCQLGASGPGDGCCVEKTSFPEGASGSPLGPRNLSCYRVSKTD
YECSWQYDGPEDNVSHVLWCCFVPPNHTHTGQERCRYFSSGPDRTVQFWEQDGIPVLSKV
NFWVESRLGNRTMKSQKISQYLYNWTKTTPPLGHIKVSQSHRQLRMDWNVSEEAGAEVQF
RRRMPTTNWTLGDCGPQVNSGSGVLGDIRGSMSESCLCPSENMAQEIQIRRRRRLSSGAP
GGPWSDWSMPVCVPPEVLPQAKIKFLVEPLNQGGRRRLTMQGQSPQLAVPEGCRGRPGAQ
VKKHLVLVRMLSCRCQAQTSKTVPLGKKLNLSGATYDLNVLAKTRFGRSTIQKWHLPAQE
LTETRALNVSVGGNMTSMQWAAQAPGTTYCLEWQPWFQHRNHTHCTLIVPEEEDPAKMVT
HSWSSKPTLEQEECYRITVFASKNPKNPMLWATVLSSYYFGGNASRAGTPRHVSVRNQTG
DSVSVEWTASQLSTCPGVLTQYVVRCEAEDGAWESEWLVPPTKTQVTLDGLRSRVMYKVQ
VRADTARLPGAWSHPQRFSFEVQISRLSIIFASLGSFASVLLVGSLGYIGLNRAAWHLCP
PLPTPCGSTAVEFPGSQGKQAWQWCNPEDFPEVLYPRDALVVEMPGDRGDGTESPQAAPE
CALDTRRPLETQRQRQVQALSEARRLGLAREDCPRGDLAHVTLPLLLGGVTQGASVLDDL
WRTHKTAEPGPPTLGQEA
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggacatgatggggctggcagggaccagcaaacacatcaccttcctcctgctttgccag
ctaggcgcctcaggcccaggtgatggctgctgcgttgagaagacatcgttcccagaggga
gcctcaggctcacccttaggacccaggaacttgagttgctacagggtttccaagacagac
tatgagtgctcctggcagtatgatggccctgaggacaatgtttctcacgtcctgtggtgc
tgctttgtccctccgaaccatacccacaccggccaggagcgctgccgctacttctcctca
ggcccagaccgcactgtgcagttctgggaacaggacggtatccctgtgctgtccaaggtc
aacttctgggtggagtctcggcttgggaaccgaaccatgaagtcccagaagatatcccag
tacctgtacaactggaccaagacgacccctcccctgggacacatcaaggtgtcacaatca
caccggcagttgcgaatggactggaatgtgtctgaagaggccggtgctgaggtacagttc
aggcgccgtatgcccacaacgaattggaccttgggtgactgcggacctcaggttaactct
ggctcaggtgtgcttggtgacattcgtgggagcatgtctgagtcctgcctctgcccttct
gagaacatggcccaagagatccagatacggaggaggaggcggctctcctcaggagcccct
ggaggtccctggagtgattggagcatgcctgtgtgtgttccacctgaagtccttccccag
gccaagattaagttcttggtggagcccctgaaccaaggtggaaggaggcgtctaaccatg
caaggacagtcaccacagctggcagtcccggaaggctgccgaggcaggcctggtgcgcag
gtgaagaagcacttggtgctggtgcgcatgctgtcctgcaggtgccaggctcagacctcg
aagaccgtgcccctgggcaagaagctgaacctctccggggccacctatgacctgaatgtg
ctcgccaaaactcgtttcggtcgcagcaccatccagaagtggcaccttcctgcccaagag
ctcacagagacaagagccctgaatgtcagcgtgggaggcaacatgacatccatgcagtgg
gcagcccaggctcccggcaccacctactgccttgagtggcagccatggttccagcacagg
aaccacacacactgtaccctgattgtaccagaagaagaggatcctgccaagatggtgaca
cacagctggagctctaaacctaccctggagcaggaggaatgttaccgcatcacagtgttc
gcctccaagaaccccaagaatcccatgctgtgggccacagtcctgtccagttactacttt
gggggtaacgcctcgagagccggtactccacgacacgtgtcggtgaggaaccaaaccggg
gactcggtgtccgtggagtggacggcgtcacagctgagcacctgcccgggggtcctgacg
caatacgtcgtgcgctgcgaggctgaagacggcgcgtgggagtcagagtggctcgtgcca
cccactaaaacccaagtgacacttgacggactgcgcagccgagtaatgtacaaggttcag
gtgcgagccgacactgcgaggctcccgggtgcctggagtcatccccagcgctttagcttt
gaggtgcagatttcccgtttatccatcattttcgcgtctctgggaagcttcgccagcgtc
ctcctcgtgggcagtctcggatacattggcttaaacagggccgcctggcacttgtgccca
cccctgcctacaccctgtggcagcactgccgtggagttccctggcagccagggcaagcag
gcttggcagtggtgcaaccctgaggacttcccggaggtgttgtacccgcgagatgcgctg
gtggtcgagatgcccggagacagaggcgacgggacagagtcgccccaggccgcccctgag
tgcgccctggacacaaggcggcccttggagactcagaggcagaggcaggtgcaggcactg
tcagaggccaggcgcctgggcctggctagggaggactgtccccgtggtgacctggcccac
gtgacactcccgctgctcctgggaggtgtgacccagggagcctctgtacttgacgatctt
tggaggacccataagactgcggagccgggaccgcccactttggggcaagaggcctga

KEGG   Mus musculus (mouse): 16162
Entry
16162             CDS       T01002                                 

Gene name
Il12rb2, A930027I18Rik, IL-12, IL-12RB2, If, Ifnm
Definition
(RefSeq) interleukin 12 receptor, beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16162 (Il12rb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16162 (Il12rb2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16162 (Il12rb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16162 (Il12rb2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16162 (Il12rb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16162 (Il12rb2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16162 (Il12rb2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig Tissue_fac Pur_ac_phosph_N IL6Ra-bind ObR_Ig VP1_VP3
Other DBs
NCBI-GeneID: 16162
NCBI-ProteinID: NP_032380
MGI: 1270861
Ensembl: ENSMUSG00000018341
Vega: OTTMUSG00000029293
UniProt: P97378
Position
6 C1; 6 30.81 cM
AA seq 874 aa
MAQTVRECSLALLFLFMWLLIKANIDVCKLGTVTVQPAPVIPLGSAANISCSLNPKQGCS
HYPSSNELILLKFVNDVLVENLHGKKVHDHTGHSSTFQVTNLSLGMTLFVCKLNCSNSQK
KPPVPVCGVEISVGVAPEPPQNISCVQEGENGTVACSWNSGKVTYLKTNYTLQLSGPNNL
TCQKQCFSDNRQNCNRLDLGINLSPDLAESRFIVRVTAINDLGNSSSLPHTFTFLDIVIP
LPPWDIRINFLNASGSRGTLQWEDEGQVVLNQLRYQPLNSTSWNMVNATNAKGKYDLRDL
RPFTEYEFQISSKLHLSGGSWSNWSESLRTRTPEEEPVGILDIWYMKQDIDYDRQQISLF
WKSLNPSEARGKILHYQVTLQEVTKKTTLQNTTRHTSWTRVIPRTGAWTASVSAANSKGA
SAPTHINIVDLCGTGLLAPHQVSAKSENMDNILVTWQPPKKADSAVREYIVEWRALQPGS
ITKFPPHWLRIPPDNMSALISENIKPYICYEIRVHALSESQGGCSSIRGDSKHKAPVSGP
HITAITEKKERLFISWTHIPFPEQRGCILHYRIYWKERDSTAQPELCEIQYRRSQNSHPI
SSLQPRVTYVLWMTAVTAAGESPQGNEREFCPQGKANWKAFVISSICIAIITVGTFSIRY
FRQKAFTLLSTLKPQWYSRTIPDPANSTWVKKYPILEEKIQLPTDNLLMAWPTPEEPEPL
IIHEVLYHMIPVVRQPYYFKRGQGFQGYSTSKQDAMYIANPQATGTLTAETRQLVNLYKV
LESRDPDSKLANLTSPLTVTPVNYLPSHEGYLPSNIEDLSPHEADPTDSFDLEHQHISLS
IFASSSLRPLIFGGERLTLDRLKMGYDSLMSNEA
NT seq 2625 nt   +upstreamnt  +downstreamnt
atggcacagactgttagagaatgctcattggcacttctttttttgttcatgtggctgctg
attaaagcaaatatagatgtgtgcaagcttggcactgtgaccgtccagcctgcccctgtg
attcctcttgggtcagctgccaatatttcctgctccttgaatcccaagcaaggctgttca
cattatcccagttctaacgaattaatcctcttaaagtttgtcaatgatgtccttgttgaa
aatctccatggcaagaaagtccatgaccacactggtcactcctccacttttcaagtcacc
aacctgtcccttggtatgaccttgtttgtctgcaagctaaactgtagcaactctcaaaag
aagccaccagtcccagtatgtggggtggagatctcagttggtgttgctccagagccacct
caaaacatatcatgtgtccaggaaggagaaaatggaactgtggcctgttcctggaactct
ggaaaagttacttatctgaaaaccaattacactttacagttaagtggaccaaacaatctg
acctgtcagaaacaatgtttttctgacaatcgtcagaattgcaatcgcctggatcttggg
atcaatctaagccctgatttagctgaatccaggttcatagtccgtgttactgccatcaac
gatcttggaaattcttcttcacttccgcatacgttcacgttcttggacatagtgatccct
cttcctccgtgggacatcagaatcaactttctaaatgcttctgggagcagaggtacactg
cagtgggaagatgaggggcaagtggtactcaatcaactcagatatcagcctcttaacagc
acgtcctggaacatggtcaatgctacaaatgccaaaggaaaatatgacctgcgagatctg
agaccgtttacagaatatgaatttcaaatctcctctaagctacatctctctggaggaagt
tggagtaattggagtgagtcactgagaacacgaacaccagaggaagagcctgttgggata
ttagacatctggtacatgaaacaagacatcgactatgacagacagcagatctctcttttc
tggaagagtctgaatccatcagaggcaagggggaagatcctccactatcaggtgacgtta
caagaggtgacaaagaaaacaacactgcagaatactacaagacacacctcctggaccagg
gtcatcccccgaactggggcttggacggcatcagtgtctgcagccaactcaaaaggcgct
tctgcacccactcacattaacatagtggacctatgtggcactgggttgctggctcctcac
caggtctctgcaaagtcggagaacatggacaacattctagtgacctggcagcctcctaag
aaagctgattctgctgttcgggagtacatagtggaatggagagctctccaaccagggagc
atcacgaagtttcccccacactggctgcggatccccccggacaacatgtctgctctgatt
tcagagaacataaagccctatatctgttatgaaatcagggtgcatgcactgtcagagagc
caaggagggtgcagctccatccggggtgactccaagcacaaagcaccagtgagtggccct
cacattactgccatcacagagaaaaaggaacgccttttcatttcctggacccacattcca
ttcccggagcaaaggggctgcatcctccattacagaatatactggaaagaacgagactcg
acagcacaacctgagctctgcgaaattcagtaccgacgctctcaaaactcacatccaata
agcagcctacagcccagggtgacatatgtcctatggatgacagctgtgacagctgctggt
gaaagtccccaaggaaatgaaagggaattttgtccacagggcaaagccaactggaaagca
ttcgtgatatcaagcatttgcatcgctatcatcacggtgggcacgttctcaattcgttac
ttccggcaaaaggcatttactctcctgtctactctcaaacctcaatggtatagcagaacc
attccagatccagcaaacagcacttgggtaaagaagtatcccattctggaggagaagatc
cagctacctacggataatctcctgatggcatggcccactcctgaagagcctgagcccctg
atcatccatgaagtcctctaccacatgatcccagttgtcagacaaccatattacttcaaa
agaggccaaggattccaaggctactctacctccaagcaagatgcaatgtatattgccaat
ccacaagctacaggaactctcacagctgagaccagacaactagtgaacctatacaaggtg
ctagaaagcagagaccctgactcaaaactggccaacctgaccagccccttgacagtcacc
ccagtgaactaccttcctagccatgaaggctatttaccctccaacatagaagatctgtca
ccacatgaggctgacccaactgattcttttgacctggagcatcaacatatttctctttcc
atttttgcatcaagttctctccgcccactcatcttcggtggtgagcggctgactctagat
cggttaaagatgggctatgactccctcatgagtaatgaggcttga

KEGG   Mus musculus (mouse): 16164
Entry
16164             CDS       T01002                                 

Gene name
Il13ra1, AI882074, CD213a, CD213a1, IL-13R-alpha-1, IL-13r[a], Il13ra, NR4
Definition
(RefSeq) interleukin 13 receptor, alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16164 (Il13ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16164 (Il13ra1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16164 (Il13ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16164 (Il13ra1)
   04090 CD molecules [BR:mmu04090]
    16164 (Il13ra1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16164 (Il13ra1)
CD molecules [BR:mmu04090]
 Proteins
  16164 (Il13ra1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_N Tissue_fac LIFR_D2
Other DBs
NCBI-GeneID: 16164
NCBI-ProteinID: NP_598751
MGI: 105052
Ensembl: ENSMUSG00000017057
Vega: OTTMUSG00000017214
UniProt: O09030 Q8BNM4
Position
X A3.3; X 20.49 cM
AA seq 424 aa
MARPALLGELLVLLLWTATVGQVAAATEVQPPVTNLSVSVENLCTIIWTWSPPEGASPNC
TLRYFSHFDDQQDKKIAPETHRKEELPLDEKICLQVGSQCSANESEKPSPLVKKCISPPE
GDPESAVTELKCIWHNLSYMKCSWLPGRNTSPDTHYTLYYWYSSLEKSRQCENIYREGQH
IACSFKLTKVEPSFEHQNVQIMVKDNAGKIRPSCKIVSLTSYVKPDPPHIKHLLLKNGAL
LVQWKNPQNFRSRCLTYEVEVNNTQTDRHNILEVEEDKCQNSESDRNMEGTSCFQLPGVL
ADAVYTVRVRVKTNKLCFDDNKLWSDWSEAQSIGKEQNSTFYTTMLLTIPVFVAVAVIIL
LFYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQSKEETDSVVLIENLK
KAAP
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgcggccagcgctgctgggcgagctgttggtgctgctactgtggaccgccaccgtg
ggccaagttgccgcggccacagaagttcagccacctgtgacgaatttgagcgtctctgtc
gaaaatctctgcacgataatatggacgtggagtcctcctgaaggagccagtccaaattgc
actctcagatattttagtcactttgatgaccaacaggataagaaaattgctccagaaact
catcgtaaagaggaattacccctggatgagaaaatctgtctgcaggtgggctctcagtgt
agtgccaatgaaagtgagaagcctagccctttggtgaaaaagtgcatctcaccccctgaa
ggtgatcctgagtccgctgtgactgagctcaagtgcatttggcataacctgagctatatg
aagtgttcctggctccctggaaggaatacaagccctgacacacactatactctgtactat
tggtacagcagcctggagaaaagtcgtcaatgtgaaaacatctatagagaaggtcaacac
attgcttgttcctttaaattgactaaagtggaacctagttttgaacatcagaacgttcaa
ataatggtcaaggataatgctgggaaaattaggccatcctgcaaaatagtgtctttaact
tcctatgtgaaacctgatcctccacatattaaacatcttctcctcaaaaatggtgcctta
ttagtgcagtggaagaatccacaaaattttagaagcagatgcttaacttatgaagtggag
gtcaataatactcaaaccgaccgacataatattttagaggttgaagaggacaaatgccag
aattccgaatctgatagaaacatggagggtacaagttgtttccaactccctggtgttctt
gccgacgctgtctacacagtcagagtaagagtcaaaacaaacaagttatgctttgatgac
aacaaactgtggagtgattggagtgaagcacagagtataggtaaggagcaaaactccacc
ttctacaccaccatgttactcaccattccagtctttgtcgcagtggcagtcataatcctc
cttttttacctgaaaaggcttaagatcattatatttcctccaattcctgatcctggcaag
atttttaaagaaatgtttggagaccagaatgatgataccctgcactggaagaagtatgac
atctatgagaaacaatccaaagaagaaacggattctgtagtgctgatagaaaacctgaag
aaagcagctccttga

KEGG   Mus musculus (mouse): 16165
Entry
16165             CDS       T01002                                 

Gene name
Il13ra2, CD213a, CD213a2, IL-13R-alpha-2
Definition
(RefSeq) interleukin 13 receptor, alpha 2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16165 (Il13ra2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16165 (Il13ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16165 (Il13ra2)
   04090 CD molecules [BR:mmu04090]
    16165 (Il13ra2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16165 (Il13ra2)
CD molecules [BR:mmu04090]
 Proteins
  16165 (Il13ra2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind LIFR_N
Other DBs
NCBI-GeneID: 16165
NCBI-ProteinID: NP_032382
MGI: 1277954
Ensembl: ENSMUSG00000031289
Vega: OTTMUSG00000018962
UniProt: O88786
Position
X F2; X 68.46 cM
AA seq 383 aa
MAFVHIRCLCFILLCTITGYSLEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCT
LEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEA
SYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCAD
YLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHI
SVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCF
FVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSKIIFIVPVCLFFIFLLLLLCLIVEKEE
PEPTLSLHVDLNKEVCAYEDTLC
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcttttgtgcatatcagatgcttgtgtttcattcttctttgtacaataactggctat
tctttggagataaaagttaatcctcctcaggattttgaaatattggatcctggattactt
ggttatctctatttgcaatggaaacctcctgtggttatagaaaaatttaagggctgtaca
ctagaatatgagttaaaataccgaaatgttgatagcgacagctggaagactataattact
aggaatctaatttacaaggatgggtttgatcttaataaaggcattgaaggaaagatacgt
acgcatttgtcagagcattgtacaaatggatcagaagtacaaagtccatggatagaagct
tcttatgggatatcagatgaaggaagtttggaaactaaaattcaggacatgaagtgtata
tattataactggcagtatttggtctgctcttggaaacctggcaagacagtatattctgat
accaactataccatgtttttctggtatgagggcttggatcatgccttacagtgtgctgat
tacctccagcatgatgaaaaaaatgttggatgcaaactgtccaacttggactcatcagac
tataaagatttttttatctgtgttaatggatcttcaaagttggaacccatcagatccagc
tatacagtttttcaacttcaaaatatagttaaaccattgccaccagaattccttcatatt
agtgtggagaattccattgatattagaatgaaatggagcacacctggaggacccattcca
ccaaggtgttacacttatgaaattgtgatccgagaagacgatatttcctgggagtctgcc
acagacaaaaacgatatgaagttgaagaggagagcaaatgaaagtgaagacctatgcttt
tttgtaagatgtaaggtcaatatatattgtgcagatgatggaatttggagcgaatggagt
gaagaggaatgttgggaaggttacacagggccagactcaaagattattttcatagtacca
gtttgtcttttctttatattccttttgttacttctttgccttattgtggagaaggaagaa
cctgaacccacattgagcctccatgtggatctgaacaaagaagtgtgtgcttatgaagat
accctctgttaa

KEGG   Mus musculus (mouse): 16169
Entry
16169             CDS       T01002                                 

Gene name
Il15ra, AA690181, IL-15RA
Definition
(RefSeq) interleukin 15 receptor, alpha chain
  KO
K05074  interleukin 15 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16169 (Il15ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16169 (Il15ra)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16169 (Il15ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16169 (Il15ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16169 (Il15ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16169 (Il15ra)
   04090 CD molecules [BR:mmu04090]
    16169 (Il15ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16169 (Il15ra)
CD molecules [BR:mmu04090]
 Proteins
  16169 (Il15ra)
SSDB
Motif
Pfam: Sushi DUF3180 Mqo
Other DBs
NCBI-GeneID: 16169
NCBI-ProteinID: NP_032384
MGI: 104644
Ensembl: ENSMUSG00000023206
Vega: OTTMUSG00000011178
UniProt: Q60819
Structure
PDB: 
2PSM

Position
2 A1; 2 8.97 cM
AA seq 263 aa
MASPQLRGYGVQAIPVLLLLLLLLLLPLRVTPGTTCPPPVSIEHADIRVKNYSVNSRERY
VCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQP
ESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAAT
MTLEPTASTSLRITEISPHSSKMTKVAISTSVLLVGAGVVMAFLAWYIKSRQPSQPCRVE
VETMETVPMTVRASSKEDEDTGA
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcctcgccgcagctccggggctatggagtccaggccattcctgtgttgctgctgctg
ctgttgctactgttgctcccgctgagggtgacgccgggcaccacgtgtccacctcccgta
tctattgagcatgctgacatccgggtcaagaattacagtgtgaactccagggagaggtat
gtctgtaactctggctttaagcggaaagctggaacatccaccctgattgagtgtgtgatc
aacaagaacacaaatgttgcccactggacaactcccagcctcaagtgcatcagagacccc
tccctagctcactacagtccagtgccaacagtagtgacaccaaaggtgacctcacagcca
gagagcccctccccctctgcaaaagagccagaagctttctctcccaaatcagataccgca
atgaccacagagacagctattatgcctggctccaggctgacaccatcccaaacaacttct
gcaggaactacagggacaggcagtcacaagtcctcccgagccccatctcttgcagcaaca
atgaccttggagcctacagcctccacctccctcaggataacagagatttctccccacagt
tccaaaatgacgaaagtggccatctctacatcggtcctcttggttggtgcaggggttgtg
atggctttcctggcctggtacatcaaatcaaggcagccttctcagccgtgccgtgttgag
gtggaaaccatggaaacagtaccaatgactgtgagggccagcagcaaggaggatgaagac
acaggagcctaa

KEGG   Mus musculus (mouse): 16184
Entry
16184             CDS       T01002                                 

Gene name
Il2ra, CD25, I, Il2r, Ly-4, Ly-43
Definition
(RefSeq) interleukin 2 receptor, alpha chain
  KO
K05068  interleukin 2 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16184 (Il2ra)
   04151 PI3K-Akt signaling pathway
    16184 (Il2ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16184 (Il2ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16184 (Il2ra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16184 (Il2ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16184 (Il2ra)
   04658 Th1 and Th2 cell differentiation
    16184 (Il2ra)
   04659 Th17 cell differentiation
    16184 (Il2ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16184 (Il2ra)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16184 (Il2ra)
   05162 Measles
    16184 (Il2ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16184 (Il2ra)
   04090 CD molecules [BR:mmu04090]
    16184 (Il2ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16184 (Il2ra)
CD molecules [BR:mmu04090]
 Proteins
  16184 (Il2ra)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 16184
NCBI-ProteinID: NP_032393
MGI: 96549
Ensembl: ENSMUSG00000026770
Vega: OTTMUSG00000011179
UniProt: P01590 Q544I2
Position
2 A1; 2 8.91 cM
AA seq 268 aa
MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKE
LVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGH
CREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTC
VDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKVAVA
SCLFLLISILLLSGLTWQHRWRKSRRTI
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgatgttggggtttctctcattaaccatagtacccagttgtcgg
gcagaactgtgtctgtatgacccacccgaggtccccaatgccacattcaaagccctctcc
tacaagaacggcaccatcctaaactgtgaatgcaagagaggtttccgaagactaaaggaa
ttggtctatatgcgttgcttaggaaactcctggagcagcaactgccagtgcaccagcaac
tcccatgacaaatcgagaaagcaagttacagctcaacttgaacaccagaaagagcaacaa
accacaacagacatgcagaagccaacacagtctatgcaccaagagaaccttacaggtcac
tgcagggagccacctccttggaaacatgaagattccaagagaatctatcatttcgtggaa
ggacagagtgttcactacgagtgtattccgggatacaaggctctacagagaggtcctgct
attagcatctgcaagatgaagtgtgggaaaacggggtggactcagccccagctcacatgt
gtagatgaaagagaacaccaccgatttctggctagtgaggaatctcaaggaagcagaaat
tcttctcccgagagtgagacttcctgccccataaccaccacagacttcccacaacccaca
gaaacaactgcaatgacggagacatttgtgctcacaatggagtataaggtagcagtggcc
agctgcctcttcctgctcatcagcatcctcctcctgagcgggctcacctggcaacacaga
tggaggaagagcagaagaaccatctag

KEGG   Mus musculus (mouse): 16185
Entry
16185             CDS       T01002                                 

Gene name
Il2rb, CD122, IL-15R, IL-15Rbeta, IL15R, IL15Rbeta, Il-2/15Rbeta, Il-2R, Il-2Rbeta, p70
Definition
(RefSeq) interleukin 2 receptor, beta chain
  KO
K05069  interleukin 2 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16185 (Il2rb)
   04151 PI3K-Akt signaling pathway
    16185 (Il2rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16185 (Il2rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16185 (Il2rb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16185 (Il2rb)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16185 (Il2rb)
   04659 Th17 cell differentiation
    16185 (Il2rb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16185 (Il2rb)
   05202 Transcriptional misregulation in cancer
    16185 (Il2rb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16185 (Il2rb)
   05162 Measles
    16185 (Il2rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16185 (Il2rb)
   04090 CD molecules [BR:mmu04090]
    16185 (Il2rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16185 (Il2rb)
CD molecules [BR:mmu04090]
 Proteins
  16185 (Il2rb)
SSDB
Motif
Pfam: IL2RB_N1 fn3
Other DBs
NCBI-GeneID: 16185
NCBI-ProteinID: NP_032394
MGI: 96550
Ensembl: ENSMUSG00000068227
UniProt: P16297
Structure
PDB: 
6DG5

Position
15 E1; 15 37.52 cM
AA seq 539 aa
MATIALPWSLSLYVFLLLLATPWASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCH
VHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRV
KTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWE
DASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
ILPMSWLRYLLLVLGCFSGFFSCVYILVKCRYLGPWLKTVLKCHIPDPSEFFSQLSSQHG
GDLQKWLSSPVPLSFFSPSGPAPEISPLEVLDGDSKAVQLLLLQKDSAPLPSPSGHSQAS
CFTNQGYFFFHLPNALEIESCQVYFTYDPCVEEEVEEDGSRLPEGSPHPPLLPLAGEQDD
YCAFPPRDDLLLFSPSLSTPNTAYGGSRAPEERSPLSLHEGLPSLASRDLMGLQRPLERM
PEGDGEGLSANSSGEQASVPEGNLHGQDQDRGQGPILTLNTDAYLSLQELQAQDSVHLI
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggctaccatagctcttccctggagcctgtccctctacgtcttcctcctgctcctggct
acaccttgggcatctgcagcagtgaaaaactgttcccatcttgaatgcttctacaactca
agagccaatgtctcttgcatgtggagccatgaagaggctctgaatgtcacaacctgccac
gtccatgccaagtcgaacctgcgacactggaacaaaacctgtgagctaactcttgtgagg
caggcatcctgggcctgcaacctgatcctcgggtcgttcccagagtcccagtcactgacc
tccgtggacctccttgacataaatgtggtgtgctgggaagagaagggttggcgtagggta
aagacctgcgacttccatccctttgacaaccttcgcctggtggcccctcattccctccaa
gttctgcacattgatacccagagatgtaacataagctggaaggtctcccaggtctctcac
tacattgaaccatacttggaatttgaggcccgtagacgtcttctgggccacagctgggag
gatgcatccgtattaagcctcaagcagagacagcagtggctcttcttggagatgctgatc
cctagtacctcatatgaggtccaggtgagggtcaaagctcaacgaaacaataccgggacc
tggagtccctggagccagcccctgacctttcggacaaggccagcagatcccatgaaggag
atcctccccatgtcatggctcagataccttctgctggtccttggttgtttttctggcttc
ttctcctgcgtctacattttggtcaagtgccggtaccttgggccatggctgaagacagtt
ctcaagtgccacatcccagatccttctgagttcttctcccagctgagctcccagcatggg
ggagaccttcagaaatggctctcctcgcctgtccccttgtccttcttcagccccagtggc
cctgcccctgagatctctccgctggaagtgctcgacggagattccaaggccgtgcagctg
ctcctgttacagaaggactctgcccctttaccctcgcccagcggccactcacaggccagc
tgcttcaccaaccagggctacttcttcttccatctgcccaatgccttggagatcgaatcc
tgccaggtgtacttcacctatgacccctgtgtggaagaggaggtggaggaggatgggtca
aggctgcccgagggatctccccacccacctctgctgcctctggctggagaacaggatgac
tactgtgccttcccgcccagggatgacctgctgctcttctccccgagcctcagcaccccc
aacactgcctatgggggcagcagagcccctgaagaaagatctccactctccctgcatgag
ggacttccctccctagcatcccgtgacctgatgggcttacagcgccctctggagcggatg
ccggaaggtgatggagaggggctgtctgccaatagctctggggagcaggccagtgtccca
gaaggcaaccttcatgggcaagatcaggacagaggccagggccccatcctgaccctgaac
accgatgcctatctgtctcttcaagaactacaggcccaagattcagtccacctaatatag

KEGG   Mus musculus (mouse): 16186
Entry
16186             CDS       T01002                                 

Gene name
Il2rg, CD132, [g]c, gamm, gamma(, gamma(c), gc, p64
Definition
(RefSeq) interleukin 2 receptor, gamma chain
  KO
K05070  interleukin 2 receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16186 (Il2rg)
   04151 PI3K-Akt signaling pathway
    16186 (Il2rg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16186 (Il2rg)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16186 (Il2rg)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16186 (Il2rg)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16186 (Il2rg)
   04659 Th17 cell differentiation
    16186 (Il2rg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16186 (Il2rg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16186 (Il2rg)
   05162 Measles
    16186 (Il2rg)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16186 (Il2rg)
   05340 Primary immunodeficiency
    16186 (Il2rg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16186 (Il2rg)
   04090 CD molecules [BR:mmu04090]
    16186 (Il2rg)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16186 (Il2rg)
CD molecules [BR:mmu04090]
 Proteins
  16186 (Il2rg)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N Interfer-bind LIFR_N IL2RB_N1
Other DBs
NCBI-GeneID: 16186
NCBI-ProteinID: NP_038591
MGI: 96551
Ensembl: ENSMUSG00000031304
Vega: OTTMUSG00000018211
UniProt: P34902 Q3UPA9
Structure
PDB: 
6DG5

Position
X D; X 43.9 cM
AA seq 369 aa
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEV
QCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKE
DIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIK
ERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSK
WSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLV
TEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPP
PCYSLKPEA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaaactattattgtcacctagatccttcttagtccttcagctgctcctgctgagg
gcagggtggagctccaaggtcctcatgtccagtgcgaatgaagacatcaaagctgatttg
atcctgacttctacagcccctgaacacctcagtgctcctactctgccccttccagaggtt
cagtgctttgtgttcaacatagagtacatgaattgcacttggaatagcagttctgagcct
caggcaaccaacctcacgctgcactataggtacaaggtatctgataataatacattccag
gagtgcagtcactatttgttctccaaagagattacttctggctgtcagatacaaaaagaa
gatatccagctctaccagacatttgttgtccagctccaggacccccagaaaccccagagg
cgagctgtacagaagctaaacctacagaatcttgtgatcccacgggctccagaaaatcta
acactcagcaatctgagtgaatcccagctagagctgagatggaaaagcagacatattaaa
gaacgctgtttacaatacttggtgcagtaccggagcaacagagatcgaagctggacggaa
ctaatagtgaatcatgaacctagattctccctgcctagtgtggatgagctgaaacggtac
acatttcgggttcggagccgctataacccaatctgtggaagttctcaacagtggagtaaa
tggagccagcctgtccactgggggagtcatactgtagaggagaatccttccttgtttgca
ctggaagctgtgcttatccctgttggcaccatggggttgattattaccctgatctttgtg
tactgttggttggaacgaatgcctccaattccccccatcaagaatctagaggatctggtt
actgaataccaagggaacttttcggcctggagtggtgtgtctaaagggctgactgagagt
ctgcagccagactacagtgaacggttctgccacgtcagcgagattccccccaaaggaggg
gccctaggagaggggcctggaggttctccttgcagcctgcatagcccttactggcctccc
ccatgttattctctgaagccggaagcctga

KEGG   Mus musculus (mouse): 16188
Entry
16188             CDS       T01002                                 

Gene name
Il3ra, CD123, CDw123, SUT-, SUT-1
Definition
(RefSeq) interleukin 3 receptor, alpha chain
  KO
K04737  interleukin 3 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16188 (Il3ra)
   04151 PI3K-Akt signaling pathway
    16188 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16188 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16188 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16188 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16188 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16188 (Il3ra)
   04090 CD molecules [BR:mmu04090]
    16188 (Il3ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16188 (Il3ra)
CD molecules [BR:mmu04090]
 Proteins
  16188 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 16188
NCBI-ProteinID: NP_032395
MGI: 96553
Ensembl: ENSMUSG00000068758
UniProt: P26952
Position
14 A1; 14 7.08 cM
AA seq 396 aa
MAANLWLILGLLASHSSDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGA
FCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAA
QDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAP
HGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPT
LTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFR
VKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLL
YRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggccgccaacctgtggctcatcctggggctcctggcatcccactcttcagatctggct
gcggtccgtgaggctccacccactgctgtgaccacgcccatccagaacctgcatatcgac
cccgcccactacacactgagctgggaccccgcccccggcgctgacatcacgacaggggct
ttttgcaggaagggcagggacatctttgtctgggctgaccccgggcttgcccgctgctca
ttccagtcgctctccctctgccatgtgaccaacttcaccgtcttcctggggaaggacagg
gctgtggcaggatccatccagttccccccagatgatgatggcgaccacgaggccgcagcc
caggacctgcgctgctgggtgcatgaggggcagctgagctgccaatgggagcggggtccg
aaagcaacgggtgacgtgcactaccggatgttctggcgtgatgtgcggctcggtcctgcc
cacaaccgcgagtgtccacactaccacagccttgatgtcaacaccgctggccccgcccct
catggtggccatgaaggctgcacccttgacctcgacactgtccttggctccacccccaac
agccctgaccttgtcccccaggtcaccatcaccgtcaacggcagtggccgcgctggcccc
gtgccctgcatggacaacactgtggacctgcagcgcgcagaggtcctggccccgcccacg
ttgacagtggagtgcaacggctctgaggcccatgcccgatgggtcgcgcggaacagattc
caccatggcctccttgggtacaccctgcaggtcaaccagagctcccgctcagagccacag
gaatacaatgtctccatcccccacttctgggtccccaacgctggtgccatctccttccgg
gtcaagtcgaggtcagaggtttaccctcggaagctcagcagctggagcgaagcctggggc
ctcgtctgccccccagaggtgatgcctgtgaagacagccttggtgacttcagtggctacg
gtgctgggggcagggctcgtggcagctgggctcctgctgtggtggaggaagtcgctgctc
taccgcctgtgcccacccattccacgcctgcgcctgcccttggcaggggagatggtcgtg
tgggaaccagctcttgaagactgcgaggtgacgcctgtgacagacgcctga

KEGG   Mus musculus (mouse): 16190
Entry
16190             CDS       T01002                                 

Gene name
Il4ra, CD124, I, Il4r
Definition
(RefSeq) interleukin 4 receptor, alpha
  KO
K05071  interleukin 4 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16190 (Il4ra)
   04151 PI3K-Akt signaling pathway
    16190 (Il4ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16190 (Il4ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16190 (Il4ra)
   04658 Th1 and Th2 cell differentiation
    16190 (Il4ra)
   04659 Th17 cell differentiation
    16190 (Il4ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16190 (Il4ra)
  09163 Immune disease
   05321 Inflammatory bowel disease
    16190 (Il4ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16190 (Il4ra)
   04090 CD molecules [BR:mmu04090]
    16190 (Il4ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16190 (Il4ra)
CD molecules [BR:mmu04090]
 Proteins
  16190 (Il4ra)
SSDB
Motif
Pfam: IL4Ra_N
Other DBs
NCBI-GeneID: 16190
NCBI-ProteinID: NP_001008700
MGI: 105367
Ensembl: ENSMUSG00000030748
Vega: OTTMUSG00000058201
UniProt: P16382 Q3U905
Position
7 F3; 7 68.94 cM
AA seq 810 aa
MGRLCTKFLTSVGCLILLLVTGSGSIKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCL
HYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSG
NVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTY
KEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQRLPLGVTI
SCLCIPLFCLFCYFSITKIKKIWWDQIPTPARSPLVAIIIQDAQVPLWDKQTRSQESTKY
PHWKTCLDKLLPCLLKHRVKKKTDFPKAAPTKSLQSPGKAGWCPMEVSRTVLWPENVSVS
VVRCMELFEAPVQNVEEEEDEIVKEDLSMSPENSGGCGFQESQADIMARLTENLFSDLLE
AENGGLGQSALAESCSPLPSGSGQASVSWACLPMGPSEEATCQVTEQPSHPGPLSGSPAQ
SAPTLACTQVPLVLADNPAYRSFSDCCSPAPNPGELAPEQQQADHLEEEEPPSPADPHSS
GPPMQPVESWEQILHMSVLQHGAAAGSTPAPAGGYQEFVQAVKQGAAQDPGVPGVRPSGD
PGYKAFSSLLSSNGIRGDTAAAGTDDGHGGYKPFQNPVPNQSPSSVPLFTFGLDTELSPS
PLNSDPPKSPPECLGLELGLKGGDWVKAPPPADQVPKPFGDDLGFGIVYSSLTCHLCGHL
KQHHSQEEGGQSPIVASPGCGCCYDDRSPSLGSLSGALESCPEGIPPEANLMSAPKTPSN
LSGEGKGPGHSPVPSQTTEVPVGALGIAVS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggggcggctttgcaccaagttcctgacctctgtgggctgtctgattttgctgttggtg
actggatctgggagcatcaaggtcctgggtgagcccacctgcttctctgactacatccgc
acttccacgtgtgagtggttcctggatagcgctgtggactgcagttctcagctctgccta
cactacaggctgatgttcttcgagttctctgaaaacctcacatgcatcccgaggaacagt
gccagcactgtgtgtgtgtgccacatggaaatgaataggccggtccaatcagacagatac
cagatggaactgtgggctgagcacagacagctgtggcagggctccttcagccccagtggt
aatgtgaagcccctagctccagacaacctcacactccacaccaatgtgtccgacgaatgg
ctgctgacctggaataacctgtacccatcgaacaacttactgtacaaagacctcatctcc
atggtcaacatctccagagaggacaaccctgcagaattcatagtctataatgtgacctac
aaggaacccaggctgagcttcccgatcaacatcctgatgtcaggggtctactatacggcg
cgtgtgagggtcagatcccagatactcactggcacctggagtgagtggagtcctagcatc
acgtggtacaaccacttccagctgcccctgatacagcgccttccactgggggtcaccatc
tcctgcctctgcatcccgttgttttgcctgttctgttacttcagcattaccaagattaag
aagatatggtgggaccagattcccaccccagcacgcagtcccttggtggccatcatcatt
caggatgcacaggtgcccctctgggataagcagacccgaagccaggagtcaaccaagtac
ccgcactggaaaacttgtctagacaagctgctgccttgcttgctgaagcacagagtaaag
aagaagacagacttcccgaaggctgccccaaccaagtctctccagagtcctggaaaggca
ggctggtgtcccatggaggtcagcaggaccgtcctctggccagagaatgttagtgtcagt
gtggtgcgctgtatggagctgtttgaggccccagtacagaatgtggaggaggaagaagat
gagatagtcaaagaggacctgagcatgtcacctgagaacagcggaggctgcggcttccag
gagagccaggcagacatcatggctcggctcactgagaacctgttttccgacttgttggag
gctgagaatgggggccttggccagtcagccttggcagagtcatgctcccctctgccttca
ggaagtgggcaggcttctgtatcctgggcctgcctccccatggggcccagtgaggaggcc
acatgccaggtcacagagcagccttcacacccaggccctctttcaggcagcccagcccag
agtgcacctactctggcttgcacgcaggtcccacttgtccttgcagacaatcctgcctac
cggagttttagtgactgctgtagcccggccccaaatcctggagagctggctccagagcag
cagcaggctgatcatctggaagaagaggagcctccaagcccggctgacccccattcttca
gggccaccaatgcagccagtggagagctgggagcagatccttcacatgagtgtcctgcag
catggggcagctgctggctccaccccagcccctgccggtggctaccaggagtttgtgcag
gcagtgaagcagggtgccgcccaggatcctggggtgcctggtgtcaggccttctggagac
cccggttacaaggccttctcgagcctgctcagcagcaatggcatccgcggggacacagca
gcagcggggactgacgatgggcatggaggctacaagcccttccagaatcctgttcctaac
cagtcccctagctccgtgcccttatttactttcggactagacacggagctgtcacccagt
cctctgaactcagacccacccaaaagccccccagaatgccttggtctggagctggggctc
aaaggaggtgactgggtgaaggcccctcctcctgcagatcaggtgcccaagccctttggg
gatgacctgggctttggtattgtgtactcgtccctcacttgccacttgtgtggccacctg
aagcaacaccacagccaggaggaaggtggccagagccccatcgttgctagccctggctgt
ggctgctgctacgatgacagatcaccatccctggggagcctctcgggggccttggaaagc
tgtcctgagggaataccaccagaagccaacctcatgtcagcacccaagacaccctcaaac
ttgtcaggggagggcaagggccctggtcactctcctgttcccagccagacgaccgaggtg
cctgtgggcgccctgggcattgctgtttcttag

KEGG   Mus musculus (mouse): 16192
Entry
16192             CDS       T01002                                 

Gene name
Il5ra, CD125, CDw125, I, Il5r
Definition
(RefSeq) interleukin 5 receptor, alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16192 (Il5ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16192 (Il5ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16192 (Il5ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16192 (Il5ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16192 (Il5ra)
   04090 CD molecules [BR:mmu04090]
    16192 (Il5ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16192 (Il5ra)
CD molecules [BR:mmu04090]
 Proteins
  16192 (Il5ra)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac fn3 Il13Ra_Ig EpoR_lig-bind
Other DBs
NCBI-GeneID: 16192
NCBI-ProteinID: NP_032396
MGI: 96558
Ensembl: ENSMUSG00000005364
Vega: OTTMUSG00000056402
UniProt: P21183 Q05A81
Position
6 E1; 6 49.19 cM
AA seq 415 aa
MVPVLLILVGALATLQADLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDL
EYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPG
SPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQ
EYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPR
NVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVST
YSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRV
CHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggtgcctgtgttactaattcttgtgggagctttggcaacactgcaagctgacttactt
aatcacaaaaagtttttacttctaccacctgtcaattttaccattaaagccactggatta
gctcaagttcttttacactgggacccaaatcctgaccaagagcaaaggcatgttgatcta
gagtatcacgtgaaaataaatgccccacaagaagacgaatatgataccagaaagactgaa
agcaaatgtgtgaccccccttcatgaaggctttgcagctagcgtgaggaccattctgaag
agcagccatacaactctggccagcagttgggtttctgctgaactcaaagctccaccagga
tctcctggaacctcggttacgaatttaacttgtaccacacacactgttgtaagtagccac
acccacttaaggccataccaagtgtcccttcgttgcacctggcttgttgggaaggatgcc
cctgaggacacacagtatttcctatactacaggtttggtgttttgactgaaaaatgccaa
gaatacagcagagatgcactgaacagaaatactgcatgctggtttcccaggacatttatc
aacagcaaagggtttgagcagcttgctgtgcacattaatggctcaagcaagcgtgctgca
atcaagccctttgatcagctgttcagtccacttgccattgaccaagtgaatcctccaagg
aatgtcacagtggaaattgaaagcaattctctctatatacagtgggagaaaccactttct
gcctttccagatcattgctttaactatgagctgaaaatttacaacacaaaaaatggtcac
attcagaaggaaaaactgatcgccaataagttcatctcaaaaattgatgatgtttctaca
tattccattcaagtgagagcagctgtgagctcaccttgcagaatgccaggaaggtggggc
gagtggagtcaacctatttatgtgggaaaggaaaggaagtccttggtagaatggcatctc
attgtgctcccaacagccgcctgcttcgtcttgttaatcttctcactcatctgcagagtg
tgtcatctatggaccaggttgtttccaccggttccggccccaaagagtaacatcaaagat
ctccctgtggttactgaatatgagaaaccttcgaatgaaaccaaaattgaagttgtacat
tgtgtggaagaggttggatttgaagtcatgggaaattccacgttttga

KEGG   Mus musculus (mouse): 16194
Entry
16194             CDS       T01002                                 

Gene name
Il6ra, CD126, I, IL, IL-6R, IL-6R-alpha, IL-6RA, Il6r
Definition
(RefSeq) interleukin 6 receptor, alpha
  KO
K05055  interleukin 6 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04659  Th17 cell differentiation
mmu04932  Non-alcoholic fatty liver disease
mmu05163  Human cytomegalovirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16194 (Il6ra)
   04066 HIF-1 signaling pathway
    16194 (Il6ra)
   04151 PI3K-Akt signaling pathway
    16194 (Il6ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16194 (Il6ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16194 (Il6ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16194 (Il6ra)
   04659 Th17 cell differentiation
    16194 (Il6ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16194 (Il6ra)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    16194 (Il6ra)
   05163 Human cytomegalovirus infection
    16194 (Il6ra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16194 (Il6ra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16194 (Il6ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16194 (Il6ra)
   04090 CD molecules [BR:mmu04090]
    16194 (Il6ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16194 (Il6ra)
CD molecules [BR:mmu04090]
 Proteins
  16194 (Il6ra)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 fn3 I-set V-set Ig_5
Other DBs
NCBI-GeneID: 16194
NCBI-ProteinID: NP_034689
MGI: 105304
Ensembl: ENSMUSG00000027947
Vega: OTTMUSG00000052883
UniProt: P22272 Q3URV7
Position
3 F1; 3 39.19 cM
AA seq 460 aa
MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHW
VYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRK
NPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEG
DKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPET
WDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQW
SEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSS
MSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKESKTTSPPPPPYSLGPLKPTFLL
VPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLFPR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgctgaccgtcggctgcacgctgttggtcgccctgctggccgcgcccgcggtcgcgctg
gtcctcgggagctgccgcgcgctggaggtggcaaatggcacagtgacaagcctgccaggg
gccaccgttaccctgatttgccccgggaaggaagcagcaggcaatgttaccattcactgg
gtgtactctggctcacaaaacagagaatggactaccacaggaaacacactggttctgagg
gacgtgcagctcagcgacactggggactatttatgctccctgaatgatcacctggtgggg
actgtgcccttgctggtggatgttcccccagaggagcccaagctctcctgcttccggaag
aacccccttgtcaacgccatctgtgagtggcgtccgagcagcaccccctctccaaccacg
aaggctgtgctgtttgcaaagaaaatcaacaccaccaacgggaagagtgacttccaggtg
ccctgtcagtattctcagcagctgaaaagcttctcctgccaggtggagatcctggagggt
gacaaagtataccacatagtgtcactgtgcgttgcaaacagtgtgggaagcaagtccagc
cacaacgaagcgtttcacagcttaaaaatggtgcagccggatccacctgccaaccttgtg
gtatcagccatacctggaaggccgcgctggctcaaagtcagctggcagcaccctgagacc
tgggacccgagttactacttgctgcagttccagcttcgataccgacctgtatggtcaaag
gagttcacggtgttgctgctcccggtggcccagtaccaatgcgtcatccatgatgccttg
cgaggagtgaagcacgtggtccaggtccgtgggaaggaggagcttgaccttggccagtgg
agcgaatggtccccagaggtcacgggcactccttggatagcagagcccaggaccaccccg
gcaggaatcctctggaaccccacacaggtctctgttgaagactctgccaaccacgaggat
cagtacgaaagttctacagaagcaacgagtgtcctcgccccagtgcaagaatcctcgtcc
atgtccctgcccacattcctggtagctggaggaagcttggcgtttgggttgcttctctgt
gtcttcatcatcctgagactcaagcagaaatggaagtcagaggctgagaaggaaagcaag
acgacctctcctccacccccaccgtattccttgggcccactgaagccgaccttccttctg
gttcctctcctcaccccacacagctctgggtctgacaataccgtaaaccacagctgcctg
ggtgtcagggacgcacagagcccttatgacaacagcaacagagactacttattccccaga
taa

KEGG   Mus musculus (mouse): 16195
Entry
16195             CDS       T01002                                 

Gene name
Il6st, 5133400A03Rik, AA389424, BB405851, CD130, D13Ertd699, D13Ertd699e, gp13, gp130
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16195 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16195 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16195 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16195 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    16195 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16195 (Il6st)
   05203 Viral carcinogenesis
    16195 (Il6st)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    16195 (Il6st)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16195 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16195 (Il6st)
   04090 CD molecules [BR:mmu04090]
    16195 (Il6st)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16195 (Il6st)
CD molecules [BR:mmu04090]
 Proteins
  16195 (Il6st)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N fn3_2 LIFR_N
Other DBs
NCBI-GeneID: 16195
NCBI-ProteinID: NP_034690
MGI: 96560
Ensembl: ENSMUSG00000021756
Vega: OTTMUSG00000044624
UniProt: Q00560 Q6PDI9
Position
13 D2.2; 13 63.73 cM
AA seq 917 aa
MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYV
NASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTM
LSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSC
MVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKL
SWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSI
KDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGK
ILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVT
AAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHL
RGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQI
PVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKD
GPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSH
IAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANNKKPCPDDLKSVDLFKKEKVSTE
GHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQYSTVVHSGYRHQVPSVQVFSRSES
TQPLLDSEERPEDLQLVDSVDGGDEILPRQPYFKQNCSQPEACPEISHFERSNQVLSGNE
EDFVRLKQQQVSDHISQPYGSEQRRLFQEGSTADALGTGADGQMERFESVGMETTIDEEI
PKSYLPQTVRQGGYMPQ
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgtcagcaccaaggatttggctagcgcaagctttgctttttttcctcaccactgaatct
ataggtcaacttttggaaccgtgtggttacatctaccctgaatttccagttgtccagcgc
ggctcgaacttcactgccatttgtgtgctgaaggaggcgtgtctgcagcattactacgtg
aatgccagctacatcgtgtggaagaccaaccatgctgctgttcccagggagcaggtcact
gtcatcaacagaaccacgtccagtgtcacgttcacagacgtggtcctcccgagcgtgcag
ctcacctgcaacatcctgtcctttgggcagatcgagcagaatgtgtatggagtcaccatg
ctttcaggctttcctccagataaacctacaaatttgacttgcattgtgaatgaggggaag
aatatgctgtgccagtgggaccccggaagggagacttaccttgaaacaaactacactttg
aaatcagagtgggcaacagagaagtttcctgattgccagtcaaagcatggcacttcatgt
atggtcagctacatgcccacctattatgtcaacattgaagtctgggtggaagcagagaat
gcccttgggaaggtctcctcagagtctatcaattttgaccccgtggataaagtgaaaccc
accccaccatataatttatcagtgaccaactcagaagaattatccagtatattaaagcta
tcatgggtcagttcagggctgggcggtcttttagatctaaagtctgacatccaatatagg
accaaagatgcctcaacttggatccaggtccctcttgaagatacaatgtctcctcgaact
tccttcactgtgcaggacctcaagccttttacagaatatgtgtttaggatccggtccatt
aaggacagtgggaagggctactggagtgactggagtgaggaggctagtgggaccacatac
gaagacagaccatccagaccaccaagtttctggtataagacaaatccatcccatgggcag
gaatatagatctgtacggctcatatggaaggcactgcctctttctgaagccaatgggaaa
atcttggattatgaagtgattcttacgcagtcaaagtccgtctcacaaacgtacacagtc
actggcacagagctgaccgtgaatctcaccaatgaccgctatgtcgcgtctctagcagca
agaaacaaggtgggcaaatcagctgcagctgtcctcaccatccccagcccccacgtcaca
gctgcttattctgtagtgaatcttaaagcatttccaaaagataacctgctctgggtggaa
tggacacctccacctaaacccgtgagcaagtacatcttagagtggtgtgtgttgtcagag
aacgcaccctgtgttgaagactggcagcaggaagacgctaccgtgaatcggacccacttg
agaggacgcctcctggagagcaagtgctatcaaatcacagtaactcccgtattcgccacg
gggcccggaggctctgagtccttgaaggcgtacctcaaacaagccgctcctgccagagga
ccgactgttcggacaaagaaagtggggaaaaatgaagctgtcttagcgtgggaccagatt
cctgtggacgaccagaatggcttcattagaaactactccatatcttacagaaccagcgtg
ggaaaggagatggttgtgcatgtggattcttctcacacggagtacacgctgtcctctctg
agtagtgatacgttgtacatggtccgaatggccgcgtacacagatgaaggtgggaaagat
gggccggaattcacttttacaacaccaaagttcgctcaaggagaaatagaagccatagtc
gtgcctgtgtgcttagccttcctcctgacaaccctgctgggcgtcttgttctgctttaac
aaacgagacctaattaaaaaacacatctggcctaatgttcctgatccttccaagagtcat
attgcccagtggtcacctcacacccccccaaggcacaattttaactccaaagatcaaatg
tactcggacggcaatttcactgatgtaagcgttgtggaaatagaagcaaacaacaagaag
ccttgtccagatgacctgaagtccgtggacctgttcaagaaggagaaagtgagtacagaa
gggcacagcagtggcatcgggggctcttcatgcatgtcctcctccaggcccagcatctcc
agcaacgaggagaatgagtctgctcagagcaccgccagcacggtgcagtactccactgtg
gtgcacagcggctacaggcaccaggtcccgtccgtgcaagtgttctcaaggtccgagtcc
acccagcccctgctagactcggaggagcggccagaagacctgcagctggtggatagtgta
gacggtggggatgagatcttgcccaggcaaccgtatttcaagcagaactgcagtcagcct
gaagcctgtccagagatttcacattttgaaaggtcaaaccaggttttgtccggcaatgag
gaggattttgtcagactgaagcagcagcaggtttcagatcacatttctcagccctatgga
tccgagcaacggaggctgtttcaggaaggctctacagcggatgctcttggcacgggggct
gatggacagatggagagatttgaatctgttggaatggagaccacaattgatgaagaaatt
cccaaaagttacttgccacagactgtaagacaaggtggctacatgccgcagtga

KEGG   Mus musculus (mouse): 16197
Entry
16197             CDS       T01002                                 

Gene name
Il7r, CD127, IL-, IL-7Ralpha
Definition
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16197 (Il7r)
   04068 FoxO signaling pathway
    16197 (Il7r)
   04151 PI3K-Akt signaling pathway
    16197 (Il7r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16197 (Il7r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16197 (Il7r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16197 (Il7r)
  09163 Immune disease
   05340 Primary immunodeficiency
    16197 (Il7r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16197 (Il7r)
   04090 CD molecules [BR:mmu04090]
    16197 (Il7r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16197 (Il7r)
CD molecules [BR:mmu04090]
 Proteins
  16197 (Il7r)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 16197
NCBI-ProteinID: NP_032398
MGI: 96562
Ensembl: ENSMUSG00000003882
UniProt: P16872 Q5FW78 Q8C9W4
Structure
PDB: 
4NN5 4NN6 5J12 4NN7

Position
15 A1; 15 4.16 cM
AA seq 459 aa
MMALGRAFAIVFCLIQAVSGESGNAQDGDLEDADADDHSFWCHSQLEVDGSQHLLTCAFN
DSDINTANLEFQICGALLRVKCLTLNKLQDIYFIKTSEFLLIGSSNICVKLGQKNLTCKN
MAINTIVKAEAPSDLKVVYRKEANDFLVTFNAPHLKKKYLKKVKHDVAYRPARGESNWTH
VSLFHTRTTIPQRKLRPKAMYEIKVRSIPHNDYFKGFWSEWSPSSTFETPEPKNQGGWDP
VLPSVTILSLFSVFLLVILAHVLWKKRIKPVVWPSLPDHKKTLEQLCKKPKTSLNVSFNP
ESFLDCQIHEVKGVEARDEVESFLPNDLPAQPEELETQGHRAAVHSANRSPETSVSPPET
VRRESPLRCLARNLSTCNAPPLLSSRSPDYRDGDRNRPPVYQDLLPNSGNTNVPVPVPQP
LPFQSGILIPVSQRQPISTSSVLNQEEAYVTMSSFYQNK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgatggctctgggtagagctttcgctatagttttctgcttaattcaagctgtttctgga
gaaagtggaaatgcccaggatggagacctagaagatgcagacgcggacgatcactccttc
tggtgccacagccagttggaagtggatggaagtcaacatttattgacttgtgcttttaat
gactcagacatcaacacagctaatctggaatttcaaatatgtggggctcttttacgagtg
aaatgcctaactcttaacaagctgcaagatatatattttataaagacatcagaattctta
ctgattggtagcagcaatatatgtgtgaagcttggacaaaagaatttaacttgcaaaaat
atggctataaacacaatagttaaagccgaggctccctctgacctgaaagtcgtttatcgc
aaagaagcaaatgattttttggtgacatttaatgcacctcacttgaaaaagaaatattta
aaaaaagtaaagcatgatgtggcctaccgcccagcaaggggtgaaagcaactggacgcat
gtatctttattccacacaagaacaacaatcccacagagaaaactacgaccaaaagcaatg
tatgaaatcaaagtccgatccattccccataacgattacttcaaaggcttctggagcgag
tggagtccaagttctaccttcgaaactccagaacccaagaatcaaggaggatgggatcct
gtcttgccaagtgtcaccattctgagtttgttctctgtgtttttgttggtcatcttagcc
catgtgctatggaaaaaaaggattaaacctgtcgtatggcctagtctccccgatcataag
aaaactctggaacaactatgtaagaagccaaaaacgagtctgaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatgaggtgaaaggcgttgaagccagggacgaggtg
gaaagttttctgcccaatgatcttcctgcacagccagaggagttggagacacagggacac
agagccgctgtacacagtgcaaaccgctcgcctgagacttcagtcagcccaccagaaaca
gttagaagagagtcacccttaagatgcctggctagaaatctgagtacctgcaatgcccct
ccactcctttcctctaggtcccctgactacagagatggtgacagaaataggcctcctgtg
tatcaagacttgctgccaaactctggaaacacaaatgtccctgtccctgtccctcaacca
ttgcctttccagtcgggaatcctgataccagtttctcagagacagcccatctccacttcc
tcagtactgaatcaagaagaagcgtatgtcaccatgtctagtttttaccaaaacaaatga

KEGG   Mus musculus (mouse): 16199
Entry
16199             CDS       T01002                                 

Gene name
Il9r
Definition
(RefSeq) interleukin 9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16199 (Il9r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16199 (Il9r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16199 (Il9r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16199 (Il9r)
   04090 CD molecules [BR:mmu04090]
    16199 (Il9r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   16199 (Il9r)
CD molecules [BR:mmu04090]
 Proteins
  16199 (Il9r)
SSDB
Motif
Pfam: IL2RB_N1
Other DBs
NCBI-GeneID: 16199
NCBI-ProteinID: NP_032400
MGI: 96564
Ensembl: ENSMUSG00000020279
Vega: OTTMUSG00000006344
UniProt: Q01114 Q78PA5
Position
11; 11 A4
AA seq 468 aa
MALGRCIAEGWTLERVAVKQVSWFLIYSWVCSGVCRGVSVPEQGGGGQKAGAFTCLSNSI
YRIDCHWSAPELGQESRAWLLFTSNQVTEIKHKCTFWDSMCTLVLPKEEVFLPFDNFTIT
LHRCIMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGINLALEPLITSLSY
ELAFKRQEEAWEARHKDRIVGVTWLILEAVELNPGSIYEARLRVQMTLESYEDKTEGEYY
KSHWSEWSQPVSFPSPQRRQGLLVPRWQWSASILVVVPIFLLLTGFVHLLFKLSPRLKRI
FYQNIPSPEAFFHPLYSVYHGDFQSWTGARRAGPQARQNGVSTSSAGSESSIWEAVATLT
YSPACPVQFACLKWEATAPGFPGLPGSEHVLPAGCLELEGQPSAYLPQEDWAPLGSARPP
PPDSDSGSSDYCMLDCCEECHLSAFPGHTESPELTLAQPVALPVSSRA
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggccctgggaagatgcattgcggaaggttggaccttggagagagtggcggtgaaacag
gtctcctggttcctgatctacagctgggtctgctctggagtctgccggggagtctcggtc
ccagagcaaggaggaggagggcagaaggctggagcattcacctgtctcagcaacagtatt
tacaggatcgactgccactggtcggctccagagctgggccaggaatccagggcctggctc
ctctttaccagtaaccaggtgactgaaatcaaacacaaatgcaccttctgggacagtatg
tgtaccctggtgctgcctaaagaggaggtgttcttaccttttgacaacttcaccatcaca
cttcaccgctgcatcatgggacaggaacaggtcagcctggtggactcacagtacctgccc
aggagacacatcaagttggacccaccctctgatctgcagagcaatgtcagctctgggcgt
tgtgtcctgacctggggtatcaatcttgccctggagccattgatcacatccctcagctac
gagctggccttcaagaggcaggaagaggcctgggaggcccggcacaaggaccgtatcgtt
ggagtgacctggctcatccttgaagccgtcgaactgaatcctggttccatctacgaggcc
aggctgcgtgtccagatgactttggagagttatgaggacaagacagagggggaatattat
aagagccattggagtgagtggagccagcccgtgtcctttccttctccccagaggagacag
ggcctcctggtcccacgctggcaatggtcagccagcatccttgtagttgtgcccatcttt
cttctgctgactggctttgtccaccttctgttcaagctgtcacccaggctgaagagaatc
ttttaccagaacattccatctcccgaggcgttcttccatcctctctacagtgtgtaccat
ggggacttccagagttggacaggggcccgcagagccggaccacaagcaagacagaatggt
gtcagtacttcatcagcaggctcagagtccagcatctgggaggccgtcgccacactcacc
tatagcccggcatgccctgtgcagtttgcctgcctgaagtgggaggccacagccccgggc
ttcccagggctcccaggctcagagcatgtgctgccggcagggtgtctggagttggaagga
cagccatctgcctacctgccccaggaggactgggccccactgggctctgccaggccccct
cctccagactcagacagcggcagcagcgactattgcatgttggactgctgtgaggaatgc
cacctctcagccttcccaggacacaccgagagtcctgagctcacgctagctcagcctgtg
gcccttcctgtgtccagcagggcctga

KEGG   Mus musculus (mouse): 16847
Entry
16847             CDS       T01002                                 

Gene name
Lepr, LE, LEPROT, Leprb, Modb, Modb1, O, OB-, OB-RGRP, Obr, db, diabetes, obese-, obese-like, obl
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04152  AMPK signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16847 (Lepr)
   04152 AMPK signaling pathway
    16847 (Lepr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    16847 (Lepr)
   04060 Cytokine-cytokine receptor interaction
    16847 (Lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    16847 (Lepr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16847 (Lepr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16847 (Lepr)
   04090 CD molecules [BR:mmu04090]
    16847 (Lepr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   16847 (Lepr)
CD molecules [BR:mmu04090]
 Proteins
  16847 (Lepr)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 16847
NCBI-ProteinID: NP_666258
MGI: 104993
Ensembl: ENSMUSG00000057722
Vega: OTTMUSG00000008454
UniProt: P48356
Position
4 C6; 4 46.96 cM
AA seq 1162 aa
MMCQKFYVVLLHWEFLYVIAALNLAYPISPWKFKLFCGPPNTTDDSFLSPAGAPNNASAL
KGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTDNTEGKTLASVVKASVF
RQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDS
FQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPL
GLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENSTIVREAAEIVSATSLLVDSVLPGS
SYEVQVRSKRLDGSGVWSDWSSPQVFTTQDVVYFPPKILTSVGSNASFHCIYKNENQIIS
SKQIVWWRNLAEKIPEIQYSIVSDRVSKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRY
AELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDSPSIHPT
SEPKNCVLQRDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSN
VKAEITVNTGLLKVSWEKPVFPENNLQFQIRYGLSGKEIQWKTHEVFDAKSKSASLLVSD
LCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVKVPMRGPEFWRKMDGDVTKKERNVTL
LWKPLTKNDSLCSVRRYVVKHRTAHNGTWSEDVGNRTNLTFLWTEPAHTVTVLAVNSLGA
SLVNFNLTFSWPMSKVSAVESLSAYPLSSSCVILSWTLSPDDYSLLYLVIEWKILNEDDG
MKWLRIPSNVKKFYIHDNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDAIDKQQNDAGL
YVIVPIIISSCVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKH
AESVIFGPLLLEPEPISEEISVDTAWKNKDEMVPAAMVSLLLTTPDPESSSICISDQCNS
ANFSGSQSTQVTCEDECQRQPSVKYATLVSNDKLVETDEEQGFIHSPVSNCISSNHSPLR
QSFSSSSWETEAQTFFLLSDQQPTMISPQLSFSGLDELLELEGSFPEENHREKSVCYLGV
TSVNRRESGVLLTGEAGILCTFPAQCLFSDIRILQERCSHFVENNLSLGTSGENFVPYMP
QFQTCSTHSHKIMENKMCDLTV
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgatgtgtcagaaattctatgtggttttgttacactgggaatttctttatgtgatagct
gcacttaacctggcatatccaatctctccctggaaatttaagttgttttgtggaccaccg
aacacaaccgatgactcctttctctcacctgctggagccccaaacaatgcctcggctttg
aagggggcttctgaagcaattgttgaagctaaatttaattcaagtggtatctacgttcct
gagttatccaaaacagtcttccactgttgctttgggaatgagcaaggtcaaaactgctct
gcactcacagacaacactgaagggaagacactggcttcagtagtgaaggcttcagttttt
cgccagctaggtgtaaactgggacatagagtgctggatgaaaggggacttgacattattc
atctgtcatatggagccattacctaagaaccccttcaagaattatgactctaaggtccat
cttttatatgatctgcctgaagtcatagatgattcgcctctgcccccactgaaagacagc
tttcagactgtccaatgcaactgcagtcttcggggatgtgaatgtcatgtgccggtaccc
agagccaaactcaactacgctcttctgatgtatttggaaatcacatctgccggtgtgagt
tttcagtcacctctgatgtcactgcagcccatgcttgttgtgaaacccgatccaccctta
ggtttgcatatggaagtcacagatgatggtaatttaaagatttcttgggacagccaaaca
atggcaccatttccgcttcaatatcaggtgaaatatttagagaattctacaattgtaaga
gaggctgctgaaattgtctcagctacatctctgctggtagacagtgtgcttcctggatct
tcatatgaggtccaggtgaggagcaagagactggatggttcaggagtctggagtgactgg
agttcacctcaagtctttaccacacaagatgttgtgtattttccacccaaaattctgact
agtgttggatcgaatgcttcttttcattgcatctacaaaaacgaaaaccagattatctcc
tcaaaacagatagtttggtggaggaatctagctgagaaaatccctgagatacagtacagc
attgtgagtgaccgagttagcaaagttaccttctccaacctgaaagccaccagacctcga
gggaagtttacctatgacgcagtgtactgctgcaatgagcaggcgtgccatcaccgctat
gctgaattatacgtgatcgatgtcaatatcaatatatcatgtgaaactgacgggtactta
actaaaatgacttgcagatggtcacccagcacaatccaatcactagtgggaagcactgtg
cagctgaggtatcacaggcgcagcctgtattgtcctgatagtccatctattcatcctacg
tctgagcccaaaaactgcgtcttacagagagacggcttttatgaatgtgttttccagcca
atctttctattatctggctatacaatgtggatcaggatcaaccattctttaggttcactt
gactcgccaccaacgtgtgtccttcctgactccgtagtaaaaccactacctccatctaac
gtaaaagcagagattactgtaaacactggattattgaaagtatcttgggaaaagccagtc
tttccggagaataaccttcaattccagattcgatatggcttaagtggaaaagaaatacaa
tggaagacacatgaggtattcgatgcaaagtcaaagtctgccagcctgctggtgtcagac
ctctgtgcagtctatgtggtccaggttcgctgccggcggttggatggactaggatattgg
agtaattggagcagtccagcctatacgcttgtcatggatgtaaaagttcctatgagaggg
cctgaattttggagaaaaatggatggggacgttactaaaaaggagagaaatgtcaccttg
ctttggaagcccctgacgaaaaatgactcactgtgtagtgtgaggaggtacgtggtgaag
catcgtactgcccacaatgggacgtggtcagaagatgtgggaaatcggaccaatctcact
ttcctgtggacagaaccagcgcacactgttacagttctggctgtcaattccctcggcgct
tcccttgtgaattttaaccttaccttctcatggcccatgagtaaagtgagtgctgtggag
tcactcagtgcttatcccctgagcagcagctgtgtcatcctttcctggacactgtcacct
gatgattatagtctgttatatctggttattgaatggaagatccttaatgaagatgatgga
atgaagtggcttagaattccctcgaatgttaaaaagttttatatccacgataattttatt
cccatcgagaaatatcagtttagtctttacccagtatttatggaaggagttggaaaacca
aagataattaatggtttcaccaaagatgctatcgacaagcagcagaatgacgcagggctg
tatgtcattgtacccataattatttcctcttgtgtcctactgctcggaacactgttaatt
tcacaccagagaatgaaaaagttgttttgggacgatgttccaaaccccaagaattgttcc
tgggcacaaggactgaatttccaaaagcctgaaacatttgagcatctttttaccaagcat
gcagaatcagtgatatttggtcctcttcttctggagcctgaacccatttcagaagaaatc
agtgtcgatacagcttggaaaaataaagatgagatggtcccagcagctatggtctccctt
cttttgaccacaccagaccctgaaagcagttctatttgtattagtgaccagtgtaacagt
gctaacttctctgggtctcagagcacccaggtaacctgtgaggatgagtgtcagagacaa
ccctcagttaaatatgcaactctggtcagcaacgataaactagtggaaactgatgaagag
caagggtttatccatagtcctgtcagcaactgcatctccagtaatcattccccactgagg
cagtctttctctagcagctcctgggagacagaggcccagacatttttccttttatcagac
cagcaacccaccatgatttcaccacaactttcattctcggggttggatgagcttttggaa
ctggagggaagttttcctgaagaaaatcacagggagaagtctgtctgttatctaggagtc
acctccgtcaacagaagagagagtggtgtgcttttgactggtgaggcaggaatcctgtgc
acattcccagcccagtgtctgttcagtgacatcaggatcctccaggagagatgctcacac
tttgtagaaaataatttgagtttagggacctctggtgagaactttgtaccttacatgccc
caatttcaaacctgttccacgcacagtcacaagataatggagaataagatgtgtgactta
actgtgtaa

KEGG   Mus musculus (mouse): 16880
Entry
16880             CDS       T01002                                 

Gene name
Lifr, A230075M04Rik, AW061234, LIF
Definition
(RefSeq) LIF receptor alpha
  KO
K05058  leukemia inhibitory factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16880 (Lifr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16880 (Lifr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16880 (Lifr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16880 (Lifr)
   04090 CD molecules [BR:mmu04090]
    16880 (Lifr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16880 (Lifr)
CD molecules [BR:mmu04090]
 Proteins
  16880 (Lifr)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 Pur_ac_phosph_N IL6Ra-bind PhoD_N TMEM154
Other DBs
NCBI-GeneID: 16880
NCBI-ProteinID: NP_038612
MGI: 96788
Ensembl: ENSMUSG00000054263
UniProt: P42703
Structure
PDB: 
2Q7N

Position
15 A1; 15 3.46 cM
AA seq 1092 aa
MAAYSWWRQPSWMVDNKRSRMTPNLPWLLSALTLLHLTMHANGLKRGVQDLKCTTNNMRV
WDCTWPAPLGVSPGTVKDICIKDRFHSCHPLETTNVKIPALSPGDHEVTINYLNGFQSKF
TLNEKDVSLIPETPEILDLSADFFTSSLLLKWNDRGSALPHPSNATWEIKVLQNPRTEPV
ALVLLNTMLSGKDTVQHWNWTSDLPLQCATHSVSIRWHIDSPHFSGYKEWSDWSPLKNIS
WIRNTETNVFPQDKVVLAGSNMTICCMSPTKVLSGQIGNTLRPLIHLYGQTVAIHILNIP
VSENSGTNIIFITDDDVYGTVVFAGYPPDVPQKLSCETHDLKEIICSWNPGRITGLVGPR
NTEYTLFESISGKSAVFHRIEGLTNETYRLGVQMHPGQEIHNFTLTGRNPLGQAQSAVVI
NVTERVAPHDPTSLKVKDINSTVVTFSWYLPGNFTKINLLCQIEICKANSKKEVRNATIR
GAEDSTYHVAVDKLNPYTAYTFRVRCSSKTFWKWSRWSDEKRHLTTEATPSKGPDTWREW
SSDGKNLIVYWKPLPINEANGKILSYNVSCSLNEETQSVLEIFDPQHRAEIQLSKNDYII
SVVARNSAGSSPPSKIASMEIPNDDITVEQAVGLGNRIFLTWRHDPNMTCDYVIKWCNSS
RSEPCLLDWRKVPSNSTETVIESDQFQPGVRYNFYLYGCTNQGYQLLRSIIGYVEELAPI
VAPNFTVEDTSADSILVKWDDIPVEELRGFLRGYLFYFQKGERDTPKTRSLEPHHSDIKL
KNITDISQKTLRIADLQGKTSYHLVLRAYTHGGLGPEKSMFVVTKENSVGLIIAILIPVA
VAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSNALKTLEMNPCTP
NNVEVLESRSIVPKIEDTEIISPVAERPGERSEVDPENHVVVSYCPPIIEEEITNPAADE
VGGASQVVYIDVQSMYQPQAKAEEEQDVDPVVVAGYKPQMRLPISPAVEDTAAEDEEGKT
AGYRPQANVNTWNLVSPDSPRSTDSNNEVVSFGSPCSINSRQFLIPPKDEDSPKSNGGGW
SFTNFFQNKPND
NT seq 3279 nt   +upstreamnt  +downstreamnt
atggcagcttactcatggtggagacagccatcgtggatggtagacaataaaagatcgagg
atgactccaaacctgccatggctcctgtcagctctgaccctcctgcatctgacgatgcat
gcaaacggtctgaagagaggggtacaagacttgaaatgcacaaccaacaacatgcgagtg
tgggactgcacgtggccagctcccctcggggtcagccctggaactgttaaagatatttgc
attaaagacaggttccattcttgtcacccattagagacaacaaacgttaaaattccagct
ctttcacctggtgatcacgaagtcacaataaattatctaaatggctttcagagtaaattc
acgttgaatgaaaaagatgtctctttaattccagagactcccgagatcctggatttgtct
gctgacttcttcacctcctccttactactgaagtggaacgacagagggtctgctctgcct
cacccctccaatgccacctgggagattaaggttctacagaatccaaggacggaaccagta
gcactcgtgttactcaacacaatgctgagtggtaaagataccgttcagcactggaactgg
acctcagacctgcccttgcaatgtgccactcactcggtgagcattcgatggcacattgac
tcgcctcatttctccggttacaaagagtggagtgactggagcccgctgaagaacatctcc
tggattcgtaatacagagactaatgtttttcctcaagacaaagtggtgctcgcaggctca
aacatgacaatttgttgtatgagtccaacgaaagtgctttcaggacagatcggcaatacc
cttcgtcctctcatccatctgtacgggcaaaccgttgcgatccatatcctgaacatcccc
gtttctgaaaacagtggcacaaacatcattttcatcacagacgacgatgtgtacggaacg
gtggtctttgcaggctatcctcccgatgttcctcagaagctgagctgtgagacacatgac
ttaaaagagattatatgtagctggaatccaggaaggataactggactggtgggcccacga
aatacagaatacaccctgtttgaaagcatttcaggaaaatcggcagtatttcacaggatt
gaaggacttacaaacgagacctaccggttaggcgtgcaaatgcatcccggccaagaaatc
cataacttcaccctgactggtcgcaatccactggggcaggcacagtcagcagtggtcatc
aatgtgactgagagagttgctcctcatgatccgacttcgttgaaagtgaaggacatcaat
tcaacagttgttacattttcttggtatttaccaggaaattttacaaagattaatctttta
tgtcaaattgaaatttgtaaagctaattccaagaaagaagtgaggaatgccacaatcaga
ggagccgaggattcaacttaccatgttgctgtagacaaattaaatccatacactgcatac
actttccgggttcgttgttcttccaagactttctggaagtggagcaggtggagtgatgag
aagcgacatctaaccacagaagccactccttcaaagggaccagacacttggagagagtgg
agttctgatggaaaaaatctaatcgtctactggaagcctttacctattaatgaagctaat
ggaaaaatactttcctacaatgtttcgtgttcattgaacgaggagacacagtcagttttg
gagatcttcgatcctcaacacagagcagagatacagcttagtaaaaatgactacatcatc
agtgtggtggcaagaaattctgctggctcatcaccaccttcgaaaatagctagtatggaa
atcccaaatgacgacatcacagtagagcaagcggtggggctaggaaacaggatcttcctc
acctggcgtcacgaccccaacatgacttgtgactacgtaattaaatggtgcaactcatct
cggtctgagccctgcctcctggactggagaaaggttccttcaaacagcacggagactgtc
atagagtctgatcagtttcagccaggagtaagatacaacttttacctctatgggtgcact
aaccagggataccaactgttacgttccataattggatacgtagaagaactggctcccatt
gtcgcgccaaatttcaccgtggaagatacgtcggcagactcgatattagtgaaatgggac
gacatccccgtggaagagctccgaggcttcctaagagggtatttattttactttcagaaa
ggagagagagatacgcccaagacgaggagcttggagccacatcattctgacatcaagcta
aagaacatcactgacatatcccagaagacactgaggattgctgaccttcagggtaaaacc
agttaccatctggtcctgcgagcctatacacatggtggtctgggcccagagaagagcatg
tttgtggtgaccaaggaaaactctgtgggattgattattgccatcctcatcccagtggct
gtggctgtcattgttggcgtggtaacgagcatcctttgctatcggaagcgagaatggatt
aaggaaacattctacccagatattcccaatccagaaaactgtaaggcgctacagtttcag
aagagcgtctgcgagggaagcaatgctcttaagacattggaaatgaacccctgtaccccg
aacaacgttgaagtcctggaatctcggtcgatagtccctaaaatagaagatacagaaata
atttccccagttgctgagcgtcctggggaaagatctgaggtggaccctgagaaccatgtg
gtcgtgtcttactgcccacccatcatcgaggaggaaataacgaaccccgcggccgatgaa
gtgggaggggcttcccaggtcgtgtacatcgatgtgcagtccatgtatcagccgcaagcc
aaagcagaggaagagcaggacgtggatcctgtggtggtggcaggctataagccacagatg
cgccttcccatcagccccgctgtggaagacacagcagcagaagatgaagagggtaagacc
gccggttacagacctcaggccaatgtaaacacttggaatttggtctctccagattccccg
aggtccacagacagcaacaacgaagttgtctcttttggaagtccgtgctccatcaattcc
aggcaattcttgattcctcctaaagacgaagactctcctaaatctaatggaggagggtgg
tcctttacaaacttcttccagaacaaaccaaatgactaa

KEGG   Mus musculus (mouse): 17480
Entry
17480             CDS       T01002                                 

Gene name
Mpl, CD110, TP, TPO-R, c-m, c-mp, c-mpl, hlb21, hlb219
Definition
(RefSeq) myeloproliferative leukemia virus oncogene
  KO
K05082  thrombopoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    17480 (Mpl)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17480 (Mpl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    17480 (Mpl)
   04090 CD molecules [BR:mmu04090]
    17480 (Mpl)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   17480 (Mpl)
CD molecules [BR:mmu04090]
 Proteins
  17480 (Mpl)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N Tissue_fac
Other DBs
NCBI-GeneID: 17480
NCBI-ProteinID: NP_034953
MGI: 97076
Ensembl: ENSMUSG00000006389
Vega: OTTMUSG00000008795
UniProt: Q08351
Position
4 D2.1; 4 54.61 cM
AA seq 625 aa
MPSWALFMVTSCLLLALPNQAQVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPS
GTYQLLYAYRGEKPRACPLYSQSVPTFGTRYVCQFPAQDEVRLFFPLHLWVKNVSLNQTL
IQRVLFVDSVGLPAPPRVIKARGGSQPGELQIHWEAPAPEISDFLRHELRYGPTDSSNAT
APSVIQLLSTETCCPTLWMPNPVPVLDQPPCVHPTASQPHGPAPFLTVKGGSCLVSGLQA
GKSYWLQLRSQPDGVSLRGSWGPWSFPVTVDLPGDAVTIGLQCFTLDLKMVTCQWQQQDR
TSSQGFFRHSRTRCCPTDRDPTWEKCEEEEPRPGSQPALVSRCHFKSRNDSVIHILVEVT
TAQGAVHSYLGSPFWIHQAVLLPTPSLHWREVSSGRLELEWQHQSSWAAQETCYQLRYTG
EGREDWKVLEPSLGARGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSET
AWITLVTALLLVLSLSALLGLLLLKWQFPAHYRRLRHALWPSLPDLHRVLGQYLRDTAAL
SPSKATVTDSCEEVEPSLLEILPKSSESTPLPLCPSQPQMDYRGLQPCLRTMPLSVCPPM
AETGSCCTTHIANHSYLPLSYWQQP
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgccctcttgggccctcttcatggtcacctcctgcctcctcttggcccttccaaaccag
gcacaagtcaccagccaagatgtcttcttgctggccttgggcacagagcccctgaactgc
ttctcccaaacatttgaggacctcacctgcttctgggatgaggaagaggcagcacccagt
gggacataccagctgctgtatgcctaccgaggagagaagccccgtgcatgccccctgtat
tcccagagtgtgcccacctttggaacccggtatgtgtgccagtttccagcccaggatgaa
gtgcgcctcttctttccgctgcacctctgggtgaagaatgtgtccctcaaccagactttg
atccagcgggtgctgtttgtggatagtgtgggcctgccagctccccccagggtcatcaag
gccaggggtgggagccaaccaggggaacttcagatccactgggaggcccctgctcctgaa
atcagtgacttcctgaggcatgaactccgctatggccccacggactccagcaacgccact
gccccctccgtcattcagctgctctccacagaaacctgctgccccactttgtggatgccg
aacccagtccctgttcttgaccagcctccgtgtgttcatccgacagcatcccaaccgcat
ggaccagctccatttctgacagtgaagggtggaagctgtctcgtctcaggcctccaggct
ggcaaatcctactggctccagctacgcagccaacccgacggggtctcccttcgtggctcc
tggggaccctggtccttccctgtgactgtggatcttccaggagatgcagtgacaattgga
cttcagtgctttaccttggatctgaagatggtcacctgccagtggcagcaacaagaccgc
actagctcccaaggcttcttccgccacagcaggacgaggtgctgccccacagacagggac
cccacctgggagaaatgtgaagaggaggaaccgcgtccaggatcacagcccgctctcgtc
tcccgctgccacttcaagtcacgaaatgacagtgttattcacatccttgtagaggtgacc
acagcgcaaggtgccgttcacagctacctgggctcccctttttggatccaccaggctgtg
ctccttcccaccccgagcctgcactggagggaggtctcaagtggaaggctggagttggag
tggcagcaccagtcatcttgggcagctcaagagacctgctaccagctccggtacacggga
gaaggccgtgaggactggaaggtgctggagccatctctcggtgcccggggagggacccta
gagctgcgcccccgagctcgctacagcttgcagctgcgtgccaggctcaacggccccacc
taccaaggtccctggagcgcctggtctcccccagctagggtgtccacgggctccgagact
gcttggatcaccttggtgactgctctgctcctggtgctgagcctcagtgcccttctgggc
ctactgctgctaaagtggcaatttcctgcgcactacaggagactgaggcatgctttgtgg
ccctcgcttccagacctacaccgggtcctaggccagtacctcagagacactgcagcccta
agtccttctaaggccacggttaccgatagctgtgaagaagtggaacccagcctcctggaa
atcctccctaagtcctcagagagcactcctttacctctgtgtccctcccaacctcagatg
gactacagaggactgcaaccttgcctgcggaccatgcccctgtctgtgtgtccacccatg
gctgagacggggtcctgctgcaccacacacattgccaaccactcctacctaccactaagc
tattggcagcagccctga

KEGG   Mus musculus (mouse): 18414
Entry
18414             CDS       T01002                                 

Gene name
Osmr, OS, OSMRB
Definition
(RefSeq) oncostatin M receptor
  KO
K05057  oncostatin M receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    18414 (Osmr)
   04151 PI3K-Akt signaling pathway
    18414 (Osmr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18414 (Osmr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    18414 (Osmr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   18414 (Osmr)
SSDB
Motif
Pfam: LIFR_D2 fn3 EpoR_lig-bind IL6Ra-bind
Other DBs
NCBI-GeneID: 18414
NCBI-ProteinID: NP_035149
MGI: 1330819
Ensembl: ENSMUSG00000022146
Vega: OTTMUSG00000040092
UniProt: O70458 Q3TRK8 G3X8V6
Position
15 A1; 15 3.3 cM
AA seq 971 aa
MAFSVVLHPAFLLAVLSLRASRSEVLEEPLPLTPEIHKVSFQLKLQEVNLEWTVPALTHE
ELNMIFQIEISRLNISNTIWVENYSTTVKREEAVRWNWTSDIPLECVKHFIRIRALVDDT
KSLPQSSWGNWSSWKEVNAKVSVEPDKSLIFPKDKVLEEGSNVTICLMYGQNVYNVSCKL
QDEPIHGEQLDSHVSLLKLNNVVFLSDTGTNINCQATKGPKRIFGTVLFVSKVLEEPKNV
SCETRDFKTLDCSWEPGVDTTLTWRKQRFQNYTLCESFSKRCEVSNYRNSYTWQITEGSQ
EMYNFTLTAENQLRKRSVNINFNLTHRVHPKAPQDVTLKIIGATKANMTWKVHSHGNNYT
LLCQVKLQYGEVIHEHNVSVHMSANYLFSDLDPDTKYKAFVRCASANHFWKWSDWTQKEF
STPETAPSQALDVWRQVWSENGRRIVTLFWKPLLKSQANGKIISYNIVVENEAKPTESEH
YCVWAPALSTNLSLDLQPYKIRITANNSMGASPESLMVLSNDSGHEEVKEKTIKGIKDAF
NISWEPVSGDTMGYVVDWCAHSQDQRCDLQWKNLGPNTTSTTITSDDFKPGVRYNFRIFE
RSVEHKARLVEKQRGYTQELAPLVNPKVEIPYSTPNSFVLRWPDYDSDFQAGFIKGYLVY
VKSKEMQCNQPWERTLLPDNSVLCKYDINGSETKTLTVENLQPESLYEFFVTPYTSAGPG
PNETFTKVTTPDARSHMLLQIILPMTLCVLLSIIVCYWKSQWVKEKCYPDIPNPYKSSIL
SLIKSKKNPHLIMNVKDCIPDVLEVINKAEGSKTQCVGSGKLHIEDVPTKPPIVPTEKDS
SGPVPCIFFENFTYDQSAFDSGSHGLIPGPLKDTAHQLGLLAPPNKFQNVLKNDYMKPLV
ESPTEETSLIYVSQLASPMCGDKDTLATEPPVPVHGSEYKRQMVVPGSLASPSLKEDNSL
TSTVLLGQGEQ
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggctttctctgtggtccttcatccagccttcctcctggcagtgctgtccctgagggca
tcccgaagcgaagtcttggaggagcctttaccattgactcctgagatacataaagtttct
tttcaattgaaacttcaagaagtgaatttagaatggactgtcccagcccttactcatgaa
gaattaaacatgatatttcagatagagatcagtagactgaacatatccaacaccatctgg
gtggagaattatagcaccactgtgaagcgtgaagaagctgtgcgttggaactggacgtct
gatatccctttggagtgtgtcaaacatttcataagaatcagggctctggtagatgacacc
aagtcccttccacagagttcctggggcaactggagttcctggaaagaagttaatgcaaag
gtttccgttgaacctgataaatcattaatatttcctaaagacaaagtgttggaagaaggc
tccaatgtcaccatctgtctgatgtatgggcagaatgtatataatgtatcctgtaagttg
caagatgagccaatccatggagaacaacttgattcccacgtgtcattattaaaattgaac
aatgtagttttccttagtgacacagggacaaacatcaattgtcaagccacgaagggtcct
aaaagaatatttggtactgttctctttgtctcgaaagtgctcgaggaacctaagaatgtt
tcctgtgaaacccgagactttaagactttggactgttcatgggaacctggggtagatacg
actttgacttggcgtaaacaaagattccaaaactacactttatgtgaatcgttctctaag
agatgtgaggtttctaactacaggaactcctatacctggcaaatcactgaaggctcacag
gaaatgtataactttactctcacagctgaaaaccaactaaggaaaagaagtgtcaacatt
aattttaacctgacccatagagttcatccaaaggctccgcaggacgtcacccttaaaatt
ataggtgctacaaaagccaacatgacttggaaggttcactcccatggaaacaactacaca
cttttgtgtcaggttaaactccaatatggagaagtgattcatgagcacaatgtttctgtc
cacatgagcgcaaactacctcttcagtgatctggatccagacacaaagtacaaggctttt
gtgcgctgtgcaagtgccaaccacttctggaaatggagcgactggacccaaaaagagttc
agcacacccgagactgctccctcacaggctcttgatgtatggagacaagtgtggtcggag
aatggaagacgcattgtgactttattctggaagccactattaaaatcacaggccaatggc
aaaatcatatcctataatatagttgtagaaaatgaagccaaaccaactgagtcagaacac
tactgtgtctgggcaccagccctcagcacaaacctgagccttgacctgcaaccttacaag
attcgcatcacagccaacaacagcatgggggcatctcctgagtccttgatggtcctttct
aatgattctggacacgaagaggtcaaggaaaagacaattaaaggtataaaggatgcattc
aatatttcttgggagcccgtatctggagacacgatgggctatgttgtggactggtgtgca
cattcccaggaccaacgctgtgatttgcagtggaagaaccttggtcccaataccacaagc
accaccatcacctcagatgattttaaaccaggcgtccgttacaacttcagaatttttgaa
aggtctgtggaacacaaagctcggttagtagagaaacaaagaggatacacccaggaactg
gctcctttggtgaatccaaaagtggagattccttactcgacccctaactccttcgttcta
agatggccagattatgacagcgacttccaggctggttttataaaagggtacctcgtgtat
gtgaaatccaaggagatgcagtgcaaccaaccctgggaaaggaccctccttccagataat
tcagtcctctgtaaatacgacatcaatggctcagagacaaagacactcaccgtggaaaac
cttcagccagagtccctctatgagtttttcgtcactccgtacaccagcgctggcccagga
cccaatgaaacgttcacaaaggtcacaactccagatgcacgctcccacatgctgctgcag
atcatactacccatgaccctctgcgtcttgctcagcatcattgtctgctactggaaaagt
cagtgggtgaaggagaagtgctaccctgacattcccaatccgtacaagagcagcattctg
tcactcataaaatccaagaagaatcctcacttaataatgaatgtcaaagactgcattcca
gatgtccttgaagtgataaacaaagcagaaggcagcaagacacagtgtgtaggctctggg
aaacttcacattgaagatgtacccactaagccgccaatcgtgccaacagaaaaggattcc
tcagggcctgtgccctgcatcttctttgagaattttacttacgatcagtcagcttttgac
tctggttcccatggcctcattccaggtcccctaaaagacacagcacaccaacttggacta
ttggctccacctaacaagttccagaacgtattaaaaaatgactacatgaagcccctggtc
gaaagtccaactgaagaaactagcttgatttatgtgtcacagctggcttcacccatgtgc
ggagacaaggacacgcttgccacagaaccacccgtgccagtgcatggttcagagtataaa
aggcaaatggtagttcccgggagcctcgcatcaccttctctgaaggaggataacagcttg
acctcaacggtcctcttaggccaaggtgaacagtaa

KEGG   Mus musculus (mouse): 18595
Entry
18595             CDS       T01002                                 

Gene name
Pdgfra, AI115593, CD140, CD140a, Pdgfr, Pdgfr-2
Definition
(RefSeq) platelet derived growth factor receptor, alpha polypeptide
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18595 (Pdgfra)
   04014 Ras signaling pathway
    18595 (Pdgfra)
   04015 Rap1 signaling pathway
    18595 (Pdgfra)
   04630 JAK-STAT signaling pathway
    18595 (Pdgfra)
   04020 Calcium signaling pathway
    18595 (Pdgfra)
   04072 Phospholipase D signaling pathway
    18595 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    18595 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18595 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18595 (Pdgfra)
   04540 Gap junction
    18595 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18595 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18595 (Pdgfra)
   05206 MicroRNAs in cancer
    18595 (Pdgfra)
   05230 Central carbon metabolism in cancer
    18595 (Pdgfra)
   05231 Choline metabolism in cancer
    18595 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    18595 (Pdgfra)
   05218 Melanoma
    18595 (Pdgfra)
   05215 Prostate cancer
    18595 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18595 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18595 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18595 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18595 (Pdgfra)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18595 (Pdgfra)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18595 (Pdgfra)
CD molecules [BR:mmu04090]
 Proteins
  18595 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Ig_6 C2-set_2 DUF3475 C1-set Kinase-like
Other DBs
NCBI-GeneID: 18595
NCBI-ProteinID: NP_001076785
MGI: 97530
Ensembl: ENSMUSG00000029231
Vega: OTTMUSG00000056081
UniProt: P26618
Position
5 C3.3; 5 39.55 cM
AA seq 1089 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPEIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVSFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaacgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaagtgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggttaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgaccgattccttagtcatcgtg
gaagaggatgactctgccatcataccttgccgcaccacagatccggagactcaagtaacc
ttgcacaataacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacgga
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaatgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccatccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgtgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagattgagcccacc
tttggccagctggaagctgtcaacttgcacgaagtcagagagttcgtggtggaggtgcag
gcctacccgacgcccaggatatcgtggctgaaggacaacttgactctgatagagaatctc
accgagatcaccactgatgtacagaagagtcaggaaacaaggtatcagagcaaattaaag
ctgatccgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattttggatctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgtacagccgaaggcacc
cctcttccagaaatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcaaatattatcacagagctccctcgccgtggc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccact
ctgcgatctgaactcacagtggcggccgcagtgttggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccgagagatggcctcgtgcttggtcggattttggga
tccggtgcatttgggaaagtggtcgaaggtacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaggct
ctcatgtctgagctgaagataatgactcacctggggccacatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataacggcgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctagactcagaagtcaaaaac
ctcctttcggacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgctcgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gcccgcaacgtcctcctggcgcaaggaaaaattgtgaagatctgtgattttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctatgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttctaccacctcagcgagatagtggagaacctgttgccgggacaatacaagaag
agttatgaaaagattcacctggacttcctaaagagtgaccatccggccgtggcacgcatg
cgggtggactctgataatgcgtacatcggtgtcacttacaaaaatgaagaggataagctg
aaggactgggaaggtggcctggacgaacagagactgagcgctgacagtggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcggacctggtggaggacagcttcctgtaa

KEGG   Mus musculus (mouse): 18596
Entry
18596             CDS       T01002                                 

Gene name
Pdgfrb, AI528809, CD140b, PDGFR-1, Pdg, Pdgfr
Definition
(RefSeq) platelet derived growth factor receptor, beta polypeptide
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18596 (Pdgfrb)
   04014 Ras signaling pathway
    18596 (Pdgfrb)
   04015 Rap1 signaling pathway
    18596 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    18596 (Pdgfrb)
   04020 Calcium signaling pathway
    18596 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    18596 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    18596 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18596 (Pdgfrb)
   04540 Gap junction
    18596 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18596 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18596 (Pdgfrb)
   05206 MicroRNAs in cancer
    18596 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    18596 (Pdgfrb)
   05231 Choline metabolism in cancer
    18596 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    18596 (Pdgfrb)
   05218 Melanoma
    18596 (Pdgfrb)
   05215 Prostate cancer
    18596 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18596 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18596 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18596 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18596 (Pdgfrb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18596 (Pdgfrb)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18596 (Pdgfrb)
CD molecules [BR:mmu04090]
 Proteins
  18596 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set TCAD9
Other DBs
NCBI-GeneID: 18596
NCBI-ProteinID: NP_032835
MGI: 97531
Ensembl: ENSMUSG00000024620
Vega: OTTMUSG00000014920
UniProt: P05622
Position
18 E1; 18 34.41 cM
AA seq 1098 aa
MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSG
AGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALP
VGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDY
IIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQ
PQDSGCPGPLAEAEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggggcttccaggagtgataccagctttagtcctcagaggccagttgttgctgtccgtg
ttatggctcctgggaccgcagacctcccggggcctagtcatcacgccccctgggccagag
tttgttctcaacatctccagcacctttgttctgacctgctcgggctcagctccggtgatg
tgggaacagatgtcccaggtgccctggcaagaagcggccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcactgggggagacactggggaatacttttgtgtc
tacaacaactcactagggccggagctcagtgagaggaagcgtatctatatctttgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccagctggaggtgacgctacat
gagaagaaagtggatatccccctacacgtaccctacgaccaccagcgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactacgtctacagcctccaggtgtcatccatcaacgtctctgtgaatgccgtg
cagactgtggtccgccagggcgagagcatcaccatccggtgcattgtgatgggcaatgat
gtggtgaacttccaatggacgtacccccgcatgaagagtgggcggctggtggagccagtg
acagactacctctttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgattcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatggc
gatgagaaagccatcaacatctctgtgatcgagaatggctacgtgcggctgctggagaca
ctgggagatgtagaaattgctgagctgcaccggagtcggacgctgcgggtggtgttcgag
gcttatccgatgccttctgtcctgtggctcaaggacaaccgtaccttgggtgactccggc
gctggcgagttagttttgtctactcgcaacatgtctgagacccggtacgtgtcagaactg
atcctggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagccttccacgag
gacgatgaggtccagctctccttcaagctgcaggtcaatgtccccgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgtggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccacgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaatgtgact
ttctgggaggaagatcaggaatacgaggtggtgagcacactgcgcctgcgccacgtggat
cagccactgtccgtacgctgcatgctgcagaactccatgggtggagattcgcaggaggtc
accgtggtcccacattccttgcccttcaaagtggtggtgatctcagccatcctggcctta
gtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggtcatgagtacatctac
gtggaccctgtgcagttgccttacgactccacctgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccacagctcacggt
ctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatcgacagccaga
agtagcgagaagcaagccttaatgtccgagctgaagattatgagtcatcttggaccccac
ctgaacgtggtcaacctgctgggggcctgcaccaaaggagggcccatctacatcatcacg
gaatactgccgatacggtgatctggtggactacctgcaccggaacaaacacaccttcttg
cagcgacactccaacaagcattgtccgcccagtgctgagctctacagcaacgccctgcca
gtggggttctccctacccagccacttgaacctgactggggagagtgacggtggctacatg
gatatgagcaaggatgaatctatagattacgtgcccatgttggacatgaaaggagacatc
aaatacgcagacattgagtcccccagctacatggccccttatgataactatgtcccatct
gcccctgaaaggacctatcgcgccaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagctaccaagtggccaacggcatggacttcttagcctctaagaac
tgtgttcaccgagacttggcggccaggaatgtgctcatctgcgagggcaagctggtcaag
atctgtgacttcggcctggctcgagacatcatgagggactcaaactacatctccaaaggc
agcaccttcctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
actttgagtgatgtctggtcttttgggatcctactctgggagatcttcacactgggtggc
accccttacccagagctgcccatgaacgaccagttctacaatgccatcaagaggggctac
cgcatggcccagcctgctcatgcctccgacgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaagtaccagcaggtagatgaggagttcctgaggagtgac
catcctgccatcctgaggtcccaagcccgctttccggggatccacagcctccgatcccct
ctggacaccagctctgttctctacactgccgtgcagcccaatgagagtgacaatgactac
atcatccccttacctgaccccaagcctgacgttgctgatgaaggtctcccagaggggtcc
cccagccttgccagttccaccttgaatgaagtcaacacttcctccaccatctcctgcgac
agtcccctggagctccaagaagagccacagcaagcagagcctgaggcacaactggagcag
ccacaggattcaggctgcccaggacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus musculus (mouse): 19116
Entry
19116             CDS       T01002                                 

Gene name
Prlr, AI987712, Pr, Pr-1, Pr-3, Prlr-rs1
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19116 (Prlr)
   04151 PI3K-Akt signaling pathway
    19116 (Prlr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19116 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    19116 (Prlr)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19116 (Prlr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    19116 (Prlr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   19116 (Prlr)
SSDB
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3
Other DBs
NCBI-GeneID: 19116
NCBI-ProteinID: NP_035299
MGI: 97763
Ensembl: ENSMUSG00000005268
Vega: OTTMUSG00000023932
UniProt: Q08501 Q8C5N1 Q3TNP6
Position
15 A1; 15 5.23 cM
AA seq 608 aa
MSSALAYMLLVLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYS
KEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDTTVWIIVAVLS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPAFHIPEITEKPENPEANIPPTPNPQNNTPNCHTDTSKSTTWPLPPGQHTRRSP
YHSIADVCKLAGSPGDTLDSFLDKAEENVLKLSEDAGEEEVAVQEGAKSFPSDKQNTSWP
PLQEKGPIVYAKPPDYVEIHKVNKDGVLSLLPKQRENHQTENPGVPETSKEYAKVSGVTD
NNILVLVPDSRAQNTALLEESAKKVPPSLEQNQSEKDLASFTATSSNCRLQLGRLDYLDP
TCFMHSFH
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtcatctgcacttgcttacatgctgcttgtcctcagcatcagcctcctgaatggacag
tcaccacctggaaaacctgaaatccacaaatgtcgttcccctgacaaggaaacattcacc
tgctggtggaatcctgggtcagatggaggactccccaccaattattcattgacatacagc
aaagaaggagagaaaaacacctatgaatgtccagactacaaaaccagtggccccaattcc
tgtttctttagcaagcagtacacttccatatggaaaatatacatcatcacagtaaatgcc
acgaacgaaatgggaagcagtacctcggatccactttatgtggatgtgacttacattgtt
gaaccagagcctcctcggaacctgactttagaagtgaaacaactaaaagacaaaaaaaca
tatctgtgggtaaaatggttgccacctaccataactgatgtaaaaactggttggtttaca
atggaatatgaaattcgattaaagtctgaagaagcagatgagtgggagatccacttcaca
ggtcatcaaacacaatttaaggtttttgacttatatccaggacaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggggccaggagaaatctattgaa
ataccaaatgacttcaccttgaaagacacaactgtgtggatcattgtggccgttctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggttatagcatgatgacc
tgcatctttccaccagttccggggccaaaaataaaaggatttgatactcatctgctagag
aagggcaagtctgaagaactgctgagtgccttggggtgccaagactttccccccacttct
gactgtgaggacttgctggtggagttcttggaagtggatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccgggtcaaggtgttaaacccacacacctagatcct
gacagtgactctggtcatggaagctatgacagccattctcttttgtctgaaaagtgtgag
gagccccaggcctacccccctgccttccacatccctgagatcactgagaagccagagaat
cctgaggcaaatattcctcccaccccaaatccccaaaataacacccccaattgtcataca
gatacatccaaatctacaacatggcctttaccacctggccaacacacgcgcagatctcct
taccacagcattgccgatgtgtgcaagctagctggaagtcctggagatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctgaagatgctggagaggaagaa
gtggctgtgcaagaaggggccaaaagcttcccttctgacaaacaaaacacatcttggcca
ccactccaggagaaaggccccattgtctatgctaaacccccagattacgtggagattcac
aaagtcaacaaagacggagtgctatcattactccccaagcagagagaaaaccaccagaca
gaaaaccctggggttcctgaaaccagtaaggagtatgccaaggtatctggggtcacggat
aacaacatcctggtgttagtgccagactcacgagcccagaacacagctttgcttgaggaa
tcagccaagaaggttccaccatcgcttgaacagaaccaatctgagaaagatctggccagc
tttactgcaacctcaagcaactgcagactccaactgggcaggctggattacctggatcct
acgtgcttcatgcactcctttcactga

KEGG   Mus musculus (mouse): 209590
Entry
209590            CDS       T01002                                 

Gene name
Il23r, IL-23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    209590 (Il23r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    209590 (Il23r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    209590 (Il23r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    209590 (Il23r)
  09163 Immune disease
   05321 Inflammatory bowel disease
    209590 (Il23r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    209590 (Il23r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   209590 (Il23r)
SSDB
Motif
Pfam: fn3 IL6Ra-bind IL12p40_C IL2RB_N1 Pur_ac_phosph_N ObR_Ig
Other DBs
NCBI-GeneID: 209590
NCBI-ProteinID: NP_653131
MGI: 2181693
Ensembl: ENSMUSG00000049093
Vega: OTTMUSG00000029859
UniProt: Q8K4B4 G5E8U4
Position
6; 6 C1
AA seq 659 aa
MKREREMRGFYYIWDMSHLTLQLHVVIALYVLFRWCHGGITSINCSGDMWVEPGEIFQMG
MNVSIYCQEALKHCRPRNLYFYKNGFKEEFDITRINRTTARIWYKGFSEPHAYMHCTAEC
PGHFQETLICGKDISSGHPPDAPSNLTCVIYEYSGNMTCTWNTGKPTYIDTKYIVHVKSL
ETEEEQQYLASSYVKISTDSLQGSRKYLVWVQAVNSLGMENSQQLHVHLDDIVIPSASII
SRAETTNDTVPKTIVYWKSKTMIEKVFCEMRYKTTTNQTWSVKEFDANFTYVQQSEFYLE
PDSKYVFQVRCQETGKRNWQPWSSPFVHQTSQETGKRNWQPWSSPFVHQTSQTVSQVTAK
SSHEPQKMEMLSATIFRGHPASGNHQDIGLLSGMVFLAIMLPIFSLIGIFNRSLRIGIKR
KVLLMIPKWLYEDIPNMENSNVAKLLQEKSVFENDNASEQALYVDPVLTEISEISPLEHK
PTDYKEERLTGLLETRDCPLGMLSTSSSVVYIPDLNTGYKPQVSNVPPGGNLFINRDERD
PTSLETTDDHFARLKTYPNFQFSASSMALLNKTLILDELCLVLNQGEFNSLDIKNSRQEE
TSIVLQSDSPSETIPAQTLLSDEFVSCLAIGNEDLPSINSYFPQNVLESHFSRISLFQK
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgaaaagagagagagaaatgagaggcttctactacatttgggacatgagtcacctcaca
cttcagctgcatgtggtgatagccctttatgtgctcttcagatggtgtcacggaggaatc
acaagtataaactgctctggtgacatgtgggttgagcctggtgaaatttttcagatgggc
atgaatgtttctatatattgccaagaagcccttaagcactgccgaccaaggaatctttac
ttttataaaaatggcttcaaagaagaatttgatatcacaaggattaatagaacaacagct
cggatttggtataaaggcttttcggaacctcatgcctatatgcattgcactgctgaatgt
cctggtcattttcaagagacactgatttgtgggaaagacatttcctctggacatccaccg
gatgcccccagcaatctgacatgtgtcatttatgaatactcaggcaacatgacatgcacc
tggaacactgggaagcctacctacatagataccaagtatattgtgcatgtgaagagtttg
gagacagaagaagaacaacaatatcttgcctcaagctatgttaagatctccactgactca
ctgcaaggcagcaggaagtatttggtatgggtccaagctgtcaattccctaggcatggag
aactcacaacaactacacgtccatctggatgatatagtgataccttctgcgtccatcatt
tccagggctgagactacaaacgatactgtacccaagaccatagtttactggaaaagcaaa
actatgattgagaaagtattctgtgagatgagatacaaaacaacaacaaaccaaacgtgg
agtgttaaagaatttgacgccaatttcacatatgtacagcagtcagaattctacctggag
ccagacagcaagtatgtatttcaagtgcgatgtcaagaaactggtaaaagaaactggcag
ccttggagttccccctttgtccaccaaacttcccaagaaactggtaaaagaaactggcag
ccttggagttccccctttgtccaccaaacttcccagacagtttcccaggttacagcaaaa
tcatcccacgaacctcagaagatggagatgctcagtgctacaatcttcagaggacatcct
gcttcaggtaatcatcaagacattggacttttgtcgggaatggtcttcttggccatcatg
ttgccgattttttctctgattgggatatttaacagatcacttcgaataggaattaaaaga
aaagttttactgatgatcccaaagtggctttatgaagatattcctaatatggaaaatagc
aatgttgcaaaattattacaggaaaaaagtgtatttgagaatgataatgccagtgagcag
gccctgtatgtggatcctgtccttacagagataagtgaaatctctcccctggaacacaaa
cccacagattacaaagaagaaaggctcacaggactccttgagacaagagactgtcctcta
ggaatgttgtctaccagttcttctgttgtgtatattcctgacctcaacactggatacaaa
ccccaggtttcaaatgttcctcctggaggaaaccttttcattaacagagatgaaagagac
cctacatcccttgagaccacagatgaccactttgccagattgaaaacatatcccaacttc
caattttctgcttcaagtatggctttactaaacaaaacactaattcttgatgaattgtgc
ctcgttttaaatcaaggagaattcaattctcttgacataaaaaactcaagacaggaggaa
accagcatcgttttgcaaagtgactcacccagtgaaactatcccagcgcagactctgttg
tctgatgaatttgtctcctgtttggcaattgggaatgaagacttgccatctattaattct
tactttccacagaacgttttggaaagccatttcagtagaatttcactcttccaaaagtag

KEGG   Mus musculus (mouse): 213208
Entry
213208            CDS       T01002                                 

Gene name
Il20rb, AV228068, Fndc, Fndc6, Gm186, Il2, Il20R2
Definition
(RefSeq) interleukin 20 receptor beta
  KO
K05137  interleukin 20 receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    213208 (Il20rb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    213208 (Il20rb)
   04061 Viral protein interaction with cytokine and cytokine receptor
    213208 (Il20rb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    213208 (Il20rb)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   213208 (Il20rb)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 213208
NCBI-ProteinID: NP_001028715
MGI: 2143266
Ensembl: ENSMUSG00000044244
Vega: OTTMUSG00000027484
UniProt: E9Q9A6
Position
9; 9 E3.3
AA seq 308 aa
MISQGVWTSPFMWFFYSMTSGFLTDAVSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVL
YCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWS
NLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRS
GDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGESLPLALALFAFVGFML
ILVVVLLSVWKMGQLLRYSCCPAVVLPDTLKITSSSQKLISCRKEEVDACAVAVLSSEHL
FGVWISQT
NT seq 927 nt   +upstreamnt  +downstreamnt
atgatttcccagggagtctggacaagtccgttcatgtggtttttctacagcatgacctca
ggttttctcacggatgcagtgtccgttttacctgcccctcagaacctctctgtacagtca
accaacatgaagcatctcttgatgtggaacccagtgacccagccgggggagacggtgctc
tattgtgtggagtatcagggggagtacgagagcctgtacatgagccacatctggatcccc
agcagtcaatgctcaccgaccaaaagtctggagtgtgatgtcaccgatgacataaccgcc
acagtgccatataacttcagggtcaaggccatgctgggctcacagacttcagcctggagc
aacctggagcacccctttaaccgaaatgcaactgtcctcaccccacccaggatggaggtc
actgaacatgggctgcatctggttattgagctggaagacctggggccccagtttgagttc
cttgtggtctactggaggagggagcctggcgccgcggaacatgttaagatggtgaggagt
ggggacattccggtgcacctagaaaccatggaaccgggggccatgtactgtgtgaaggcg
caggcactggtgaaagccatcgggaggcacagtgccttcagccagcctacgtgtgtggag
atgcaaggagagtctcttccgctggcactagctctgtttgcgtttgttggcttcatgctg
attctcgtggttgtactactctccgtctggaagatgggccagctgctccggtattcttgc
tgccccgccgttgtcctcccagacaccttgaaaataaccagttcgtctcagaagctgatc
agctgcaggaaggaggaggtggacgcctgtgctgtggctgtgctgtcctcggagcatctc
tttggggtctggatctcacagacttga

KEGG   Mus musculus (mouse): 230828
Entry
230828            CDS       T01002                                 

Gene name
Il22ra1, 9130219A07Rik, IL-22R, Il, Il22r
Definition
(RefSeq) interleukin 22 receptor, alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    230828 (Il22ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230828 (Il22ra1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    230828 (Il22ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    230828 (Il22ra1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   230828 (Il22ra1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 230828
NCBI-ProteinID: NP_839988
MGI: 2663588
Ensembl: ENSMUSG00000037157
Vega: OTTMUSG00000009729
UniProt: Q80XZ4 Q3TS18
Position
4 D3; 4 67.99 cM
AA seq 581 aa
MKTLLTILTVGSLAAHTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKY
GERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTT
IKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLE
GKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWAYSFSGAVLFSMG
FLVGLLCYLGYKYITKPPVPPNSLNVQRVLTFQPLRFIQEHVLIPVLDLSGPSSLPQPIQ
YSQVVVSGPREPPGAVWRQSLSDLTYVGQSDVSILQPTNVPAQQTLSPPSYAPKAVPEVQ
PPSYAPQVASDAKALFYSPQQGMKTRPATYDPQDILDSCPASYAVCVEDSGKDSTPGILS
TPKYLKTKGQLQEDTLVRSCLPGDLSLQKVTSLGEGETQRPKSLPSPLGFCTDRGPDLHT
LRSEEPETPRYLKGALSLLSSVQIEGHPVSLPLHVHSVSCSPSDEGPSPWGLLDSLVCPK
DEGPAVETEAMCPSAAASELEQSTELDSLFKGLALTVQWES
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaagacactactgaccatcctgacggtgggatccctggccgctcacaccactgtggac
acatccggtctccttcaacacgtgaaattccagtccagcaactttgagaacatcttgacg
tgggatggtgggcccgctagcacctctgacaccgtctacagtgtggaatataagaaatac
ggagagagaaagtggctggccaaggcgggctgccagcggatcacccagaagttctgcaac
ctgactatggagacccgcaaccacactgagttttactacgccaaggtcacggcggtcagc
gcgggaggcccaccagtcacaaagatgactgatcgtttcagctcgctgcagcacactacc
atcaaaccgcctgatgtgacctgtatccccaaagtgaggtccattcagatgctggtccac
cccacactcacaccggtcctctcggaagatggccaccagctaaccctggaggagattttc
catgacctgttctaccgcttagagctccacgtcaaccacacctaccagatgcaccttgaa
ggcaaacagagagaatacgagttccttggcctgactcccgacacagagttcctcggctcc
atcacaattttgactccgatattgtccaaggaaagtgccccctacgtgtgccgagtgaag
acgctgcccgatcggacgtgggcctactccttctcgggcgccgtgctcttttccatgggt
ttcctcgtcggcttgctctgttatctgggctacaaatacatcaccaagccacctgtacct
cctaactccctgaacgtccaacgtgtcctgacctttcaacccctacgcttcatccaagaa
cacgtactgatccctgtcttggacctcagtggccccagcagtctgcctcagcccatccag
tactcccaagtggtggtgtctgggcccagggagcctcctggagctgtgtggcggcagagc
ctgtctgacctcacctacgtagggcagtcagatgtctccatcctgcaacctaccaacgtg
ccagctcagcagacactgtccccaccatcctacgctccgaaggctgtccctgaggtccag
cccccttcctatgcgcctcaggtagcctcggatgccaaagctctgttctactcaccacaa
caggggatgaagaccaggcctgccacctatgacccgcaggacattctggacagctgccct
gcttcttatgctgtgtgtgtggaagactctggcaaagactctaccccaggcatcctctcc
actcccaaatacctcaagacaaaaggtcagctccaggaagacacacttgttagaagctgt
ctcccaggggacctttctctacagaaagtcacctccttaggtgaaggggagacacagaga
ccaaaatcactcccctcacctctgggattttgcacagacagaggacctgaccttcacaca
ctgcgcagtgaggaaccagagacaccacggtacctgaagggggcgctgtctctcctgtcc
tctgtgcagatcgagggccaccctgtctccctccctttgcacgtccattctgtctcatgt
tccccctcagacgagggaccaagtccctggggcctgctggactcccttgtgtgtccaaag
gatgagggtcccgcggttgagactgaggccatgtgccccagtgctgcagcctctgagctg
gagcagtccacagaactggactctcttttcaaaggcttggccctgactgtgcagtgggaa
tcctga

KEGG   Mus musculus (mouse): 237310
Entry
237310            CDS       T01002                                 

Gene name
Il22ra2, CRF2-10, CRF2-s1, CRF2X, Il-2, Il-22bp
Definition
(RefSeq) interleukin 22 receptor, alpha 2
  KO
K05139  interleukin 22 receptor alpha 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    237310 (Il22ra2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    237310 (Il22ra2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   237310 (Il22ra2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind PI-PLC-Y
Other DBs
NCBI-GeneID: 237310
NCBI-ProteinID: NP_839989
MGI: 2665114
Ensembl: ENSMUSG00000039760
Vega: OTTMUSG00000028020
UniProt: Q80XF5
Position
10; 10 A3
AA seq 230 aa
MMPKHCLLGLLIILLSSATEIQPARVSLTPQKVRFQSRNFHNILHWQAGSSLPSNNSIYF
VQYKMYGQSQWEDKVDCWGTTALFCDLTNETLDPYELYYGRVMTACAGRHSAWTRTPRFT
PWWETKLDPPVVTITRVNASLRVLLRPPELPNRNQSGKNASMETYYGLVYRVFTINNSLE
KEQKAYEGTQRAVEIEGLIPHSSYCVVAEMYQPMFDRRSPRSKERCVHIP
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatgcctaagcattgccttctaggtctcctcatcatactcttgagcagtgcaacagaa
atacaaccagctcgtgtatctctgacgccccagaaggtccgatttcagtccagaaatttc
cacaatattttgcactggcaagcagggagctctctccccagcaacaacagcatctacttt
gtgcagtacaagatgtatggacagagccaatgggaagataaagttgactgctgggggacc
acggcgctcttctgtgacctgaccaatgaaaccttagacccatacgagctgtattacggg
agggtgatgacggcctgtgctggacgccactctgcctggaccaggacaccccgcttcact
ccatggtgggaaacaaaactagatcctccggtcgtgactataacccgagttaacgcatct
ttgcgggtgcttctccgtcctccagagttgccaaatagaaaccaaagtggaaaaaatgca
tccatggaaacttactacggcttagtatacagagttttcacaatcaacaattcactagag
aaggagcaaaaagcctatgaaggaactcagagagctgttgaaattgaaggtctgatacct
cattccagctactgcgtagtggctgaaatgtaccagcccatgtttgacagaagaagccca
agaagcaaggagagatgtgtgcacattccatga

KEGG   Mus musculus (mouse): 237313
Entry
237313            CDS       T01002                                 

Gene name
Il20ra, E230031K19
Definition
(RefSeq) interleukin 20 receptor, alpha
  KO
K05136  interleukin 20 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    237313 (Il20ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    237313 (Il20ra)
   04061 Viral protein interaction with cytokine and cytokine receptor
    237313 (Il20ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    237313 (Il20ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   237313 (Il20ra)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 237313
NCBI-ProteinID: NP_766374
MGI: 3605069
Ensembl: ENSMUSG00000020007
Vega: OTTMUSG00000063784
UniProt: Q6PHB0
Position
10; 10 A3
AA seq 546 aa
MHTPGTPAPGHPDPPPLLLLTLLLLLAASGRAVPCVFCGLPKPTNITFLSINMKNVLHWN
PPESLHGVEVTYTVQYFIYGQKKWLNASKCGSINRTYCDLSVETSDYEHQFYAKVKAIWE
ARCSEWAETERFYPFLETQVSPPEVALTTGEKSISIALTAPEKWKRNPQDHTVSMQQIYP
NLKYNVSVYNTKSRRTWSQCVTNSTLVLSWLEPNTLYCVHVESLVPGPPRLPMPSQKQCI
STLEVQTSAWKAKVIFWYVFLTSVIVFLFSAIGYLVYRYIHVGKEKHPANLVLIYRNEIG
TRVFEPTETITLNFITFSMLDDTKISPKDMNLLDKSSDDISVNDPEHNEAWEPHWEEVEG
QHLGCSSHLMDAVCGAEQRDGDTSLTQHGWLNSTIPTGETDTEPQYKVLSDFYGEGEIQL
SCEPEEAARTEKISEPLVTSANLDPQLEDLHHLGQEHTVSEDGPEEETSITVVDWDPQTG
RLCIPSLPIFGRDPENYGHYERDQLLEGGLLSRLYENQAPDKPEKENENCLTRFMEEWGL
HVQMES
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgcacactcccgggaccccggcgccgggccacccggacccgccgccactgttgctgctc
acgctgcttctgctgctggccgcttcgggacgcgcagttccttgtgtcttctgtggtttg
cctaaacctacaaatatcaccttcttatccatcaacatgaagaatgtcctgcattggaat
ccaccagagagtctacacggagttgaagtcacatacactgtgcaatatttcatatatggg
cagaagaaatggctgaatgcctctaaatgcgggagtatcaacaggacctactgtgacctt
tctgttgagacctcagactatgaacaccagttctatgccaaagtgaaggccatttgggaa
gccaggtgctccgaatgggccgagacggaacgcttctatcctttcttggaaactcaagtc
agcccaccagaggttgccctgacaactggcgagaagtccatctctattgccctgacagca
ccagagaagtggaaaagaaatccacaagaccacactgtttctatgcaacagatatacccc
aatttgaagtacaatgtgtctgtgtataacactaagtcgagaagaacgtggtcccagtgt
gtcaccaacagcacactggtcctcagctggctggagcccaacactctgtattgtgtccac
gtggagtcccttgtcccagggccccctcgcctcccgatgccttctcagaagcagtgcatc
agtactttggaagttcaaacatcagcatggaaggctaaagtcatcttctggtatgtcttc
ctcacatctgttatcgtgtttcttttctccgcaattggctacttggtttaccgttacatc
catgttggcaaggaaaaacacccagcaaatttggtactgatttatagaaatgaaattggc
acaagagtctttgaacctactgaaacaatcacacttaattttatcaccttcagtatgttg
gatgatactaaaatttctccaaaggatatgaatttactggacaaaagcagtgatgacatc
agtgttaatgaccctgagcacaatgaggcctgggagccgcactgggaggaggtggagggg
caacatttaggatgctcttcgcatttgatggacgctgtctgtggtgctgagcaaagagac
ggagacacctccctaacccagcatgggtggcttaacagcaccatccccacaggagagaca
gacactgagcctcaatacaaagtcctaagtgacttctacggggagggtgaaatccaactg
tcctgtgagccggaagaggcggccagaacagagaaaatatctgagccactggtgacttca
gcaaacttggacccacagcttgaagacctacatcacctgggtcaggagcatactgtctcc
gaggatgggccagaggaagagacatctataacagtagtggattgggaccctcaaactggc
aggctgtgtatcccttccttacctatctttggccgtgatcctgagaactatggtcattat
gagagagaccagctcttagagggtggccttttgtctagactctatgagaaccaggcacct
gacaagccagagaaagaaaatgaaaactgtctcacacggtttatggaggaatgggggtta
catgtacaaatggaaagctag

KEGG   Mus musculus (mouse): 242700
Entry
242700            CDS       T01002                                 

Gene name
Ifnlr1, CRF2-1, CRF2-12, IF, Il, Il28ra
Definition
(RefSeq) interferon lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    242700 (Ifnlr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    242700 (Ifnlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    242700 (Ifnlr1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL10/28 receptor family
   242700 (Ifnlr1)
SSDB
Motif
Pfam: Tissue_fac
Other DBs
NCBI-GeneID: 242700
NCBI-ProteinID: NP_777276
MGI: 2429859
Ensembl: ENSMUSG00000062157
Vega: OTTMUSG00000009736
UniProt: Q8CGK5 Q3URN4
Position
4; 4 D3
AA seq 535 aa
MWRADRWAPLLLFLLQSALGRPRLAPPRNVTLFSQNFTVYLTWLPGLGSPPNVTYFVTYQ
SYIKTGWRPVEHCAGIKALVCPLMCLKKLNLYSKFKGRVQAASAHGRSPRVESRYLEYLF
DVELAPPTLVLTQMEKILRVNATYQLPPCMPSLELKYQVEFWKEGLGSKTLFPDTPYGQP
VQIPLQQGASRRHCLSARTVYTLIDIKYSQFSEPSCIFLEAPGDKRAVLAMPSLLLLLIA
AVAAGVAWKIMKGNPWFQGVKTPRALDFSEYRYPVATFQPSGPEFSDDLILCPQKELTIR
NRPAPQVRNPATLQAGPERDSTEDEDEDTDYDDDGDSVQPYLERPLFISEKPRVMEHSET
DESGVDSGGPWTSPVGSDGSSAWDSSDRSWSSTGDSSYKDEVGSSSCLDRKEPDQAPCGD
WLQEALPCLEFSEDLGTVEEPLKDGLSGWRISGSLSSKRDLAPVEPPVSLQTLTFCWVNN
PEGEEEQEDEEEEEEEEEEEDWESEPKGSNAGCWGTSSVQRTEVRGRMLGDYLVR
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtggcgggccgaccggtgggcgcccctactcctgttcctgttgcagagcgccctagga
aggccccgtctagccccacccagaaacgtgacactcttctcccagaacttcactgtttac
ctgacatggcttccggggcttgggagccccccaaatgtgacctatttcgtgacctaccaa
agctatatcaaaaccggttggcgaccagtggagcattgtgcaggtatcaaggctctggtg
tgtcccctgatgtgcctgaagaaactgaacctgtactccaagttcaaaggacgagtacag
gcagcttccgcacacggcaggtccccacgggtggagtcccggtacctggaataccttttt
gacgtggagctagccccgcccaccctggtgctcacccagatggagaagatcctaagggtc
aacgctacctaccagctgccaccttgcatgccgtcgctggaactgaagtaccaggtggaa
ttctggaaggagggtctgggaagcaagaccctgtttcctgacactccctatggccagcca
gtgcagattcctctccagcaaggtgctagccgacgccactgcctcagcgccagaaccgtc
tataccttaattgacattaagtacagccagttctctgagcccagctgcatcttcctagag
gctccaggggacaaaagagctgtcctggcaatgccctcactcttgcttctactgatagca
gccgttgcagcaggtgtggcatggaagataatgaaaggaaacccctggtttcagggggtg
aagacgccccgggcactggacttttctgaatacagatacccagtggcaacctttcagccc
agtggacctgagttctctgatgacttgatcctttgtccccagaaggaactgaccataagg
aacaggccagcccctcaggtcagaaacccagccacgctacaggcaggaccagaaagagac
agtactgaggatgaagacgaggacacagactacgatgacgacggtgacagcgtccagccc
tacctggaacggcccctcttcatcagcgagaagccccgggttatggaacactcggagaca
gacgagtctggggtggattcaggggggccttggacatccccagttgggagtgacggctcc
tctgcatgggactcttcagacaggagctggtccagcacaggggactcctcatataaggat
gaagttgggtcttccagctgtttggaccgaaaggagccggaccaggcgccctgtggggat
tggctccaggaggctctcccatgcctggaattttctgaggacttgggcaccgtggaagag
cctctgaaggatggcctctccgggtggaggatttctggttccttatcctcaaagagagat
ctggctcctgtggagcccccagtttctcttcagacactgactttctgctgggtcaacaat
cctgagggggaggaggaacaggaggacgaggaggaagaggaggaggaggaggaggaggaa
gactgggaatcagaacctaagggcagcaatgccggctgttggggcacttcaagcgtgcag
aggacggaggtcaggggccggatgctgggagattacttggtcaggtga

KEGG   Mus musculus (mouse): 50931
Entry
50931             CDS       T01002                                 

Gene name
Il27ra, CRL1, IL-, IL-27R, Tcc, Tccr, WSX-, WSX-1, Wsx1, zcytor1
Definition
(RefSeq) interleukin 27 receptor, alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    50931 (Il27ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    50931 (Il27ra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50931 (Il27ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    50931 (Il27ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   50931 (Il27ra)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 50931
NCBI-ProteinID: NP_057880
MGI: 1355318
Ensembl: ENSMUSG00000005465
Vega: OTTMUSG00000061191
UniProt: O70394 Q3UZN3
Position
8; 8 C2
AA seq 623 aa
MNRLRVARLTPLELLLSLMSLLLGTRPHGSPGPLQCYSVGPLGILNCSWEPLGDLETPPV
LYHQSQKYHPNRVWEVKVPSKQSWVTIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQ
MKPDTPQIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAETWTRLEPQLKT
DGLTPVEMQNLEPGTCYQVSGRCQVENGYPWGEWSSPLSFQTPFLDPEDVWVSGTVCETS
GKRAALLVWKDPRPCVQVTYTVWFGAGDITTTQEEVPCCKSPVPAWMEWAVVSPGNSTSW
VPPTNLSLVCLAPESAPCDVGVSSADGSPGIKVTWKQGTRKPLEYVVDWAQDGDSLDKLN
WTRLPPGNLSTLLPGEFKGGVPYRITVTAVYSGGLAAAPSVWGFREELVPLAGPAVWRLP
DDPPGTPVVAWGEVPRHQLRGQATHYTFCIQSRGLSTVCRNVSSQTQTATLPNLHLGSFK
LWVTVSTVAGQGPPGPNLSLHLPDNRIRWKALPWFLSLWGLLLMGCGLSLASTRCLQARC
LHWRHKLLPQWIWERVPDPANSNSGQPYIKEVSLPQPPKDGPILEVEEVELQPVVESPKA
SAPIYSGYEKHFLPTPEELGLLV
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgaaccggctccgggttgcacgcctcacgccgttggagcttctgctgtcgctgatgtcg
ctgctgctcgggacgcggccccacggcagtccaggtccactgcagtgctacagcgtcggt
cccctgggaatcctgaactgctcctgggaacctttgggcgacctggagactccacctgtg
ctgtatcaccagagtcagaaataccatcccaatagagtctgggaggtgaaggtgccttcc
aaacagagttgggtgaccattccccgggaacagttcaccatggctgacaaactcctcatc
tgggggacacaaaagggacggcctctgtggtcctctgtctctgtgaacctggagacccaa
atgaagccagacacaccccagatcttctctcaagtggatatttctgaggaagcaaccctg
gaggccactgtgcagtgggcgccgcccgtgtggccaccgcagaaagttctcatctgtcag
ttccggtacaaggaatgccaggctgaaacatggacccggctggagccccagctgaagaca
gatgggctgactcctgttgagatgcagaacctggaacctggcacctgctaccaggtgtct
ggccgctgccaggtggagaacggatatccatggggcgagtggagttcgcccctgtccttc
cagacgccattcttagatcctgaagatgtgtgggtatcggggaccgtctgtgaaacttct
ggcaaacgggcagccctgcttgtctggaaggacccaagaccttgtgtgcaggtgacttac
acagtctggtttggggctggagatattactacaactcaagaagaggtcccgtgctgcaag
tcccctgtccctgcatggatggagtgggctgtggtctctcctggcaacagcaccagctgg
gtgcctcccaccaacctgtctctggtgtgcttggctccagaatctgccccctgtgacgtg
ggagtgagcagtgctgatgggagcccagggataaaggtgacctggaaacaagggaccagg
aaaccgttggagtatgtggtggactgggctcaagatggtgacagcctggacaagctcaac
tggacccgtctcccccctggaaacctcagcacattgttaccaggggagttcaaaggaggg
gtcccctatcgaattacagtgactgcagtatattctggaggattagctgctgcaccctca
gtttggggattcagagaggagttagtaccccttgctgggccagcagtttggcgacttcca
gatgaccccccagggacacctgttgtagcctggggagaagtaccaagacaccagctcaga
ggccaggctactcactacaccttctgcatacagagcagaggcctctccactgtctgcagg
aacgtgagcagtcaaacccagactgccactctgcccaaccttcacttgggttccttcaag
ctgtgggtgacggtgtccaccgttgcaggacagggcccacctggtcccaacctttcactt
cacctaccagataataggatcaggtggaaagctctgccctggtttctgtccctgtggggt
ttgcttctgatgggctgtggcctgagcctggccagtaccaggtgcctacaggccaggtgc
ttacactggcggcacaagttgcttccccagtggatctgggagagggttcctgatcctgcc
aacagcaattctgggcaaccttacatcaaggaggtgagcctgccccaaccgcccaaggac
ggacccatcctggaggtggaggaagtggagctacagcctgttgtggagtcccctaaagcc
tctgccccaatttactctgggtatgagaaacacttcctgcccacaccagaggagctgggc
cttctagtctga

KEGG   Mus musculus (mouse): 57914
Entry
57914             CDS       T01002                                 

Gene name
Crlf2, CRLM2, Ly11, Ly114, T, Tpte, Tpte2, Tslpr
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    57914 (Crlf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    57914 (Crlf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    57914 (Crlf2)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   57914 (Crlf2)
SSDB
Motif
Pfam: fn3 Tissue_fac
Other DBs
NCBI-GeneID: 57914
NCBI-ProteinID: NP_057924
MGI: 1889506
Ensembl: ENSMUSG00000033467
Vega: OTTMUSG00000054032
UniProt: Q8CII9 A0A0R4J0F5
Structure
PDB: 
4NN5 4NN6 4NN7

Position
5; 5 F
AA seq 359 aa
MAWALAVILLPRLLAAAAAAAAVTSRGDVTVVCHDLETVEVTWGSGPDHHGANLSLEFRY
GTGALQPCPRYFLSGAGVTSGCILPAARAGLLELALRDGGGAMVFKARQRASAWLKPRPP
WNVTLLWTPDGDVTVSWPAHSYLGLDYEVQHRESNDDEDAWQTTSGPCCDLTVGGLDPVR
CYDFRVRASPRAAHYGLEAQPSEWTAVTRLSGAASAASCTASPAPSPALAPPLLPLGCGL
AALLTLSLLLAALRLRRVKDALLPCVPDPSGSFPGLFEKHHGNFQAWIADAQATAPPART
EEEDDLIHTKAKRVEPEDGTSLCTVPRPPSFEPRGPGGGAMVSVGGATFMVGDSGYMTL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcatgggcactcgcggtcatcctcctgcctcggctccttgcggcggcagcggcggcg
gcggcggtgacgtcacggggtgatgtcacagtcgtctgccatgacctggagacggtggag
gtcacgtggggctcgggccccgaccaccacggcgccaacttgagcctggagttccgttat
ggcactggcgccctgcaaccctgcccgcgatatttcctgtccggcgctggtgtcacttcc
gggtgcatcctccccgcggcgagggcggggctgctggagctggcactgcgcgacggaggc
ggggccatggtgtttaaggctaggcagcgcgcgtccgcctggctgaagccccgcccacct
tggaatgtgacgctgctctggacaccagacggggacgtgactgtctcctggcctgcccac
tcctacctgggcctggactacgaggtgcagcaccgggagagcaatgacgatgaggacgcc
tggcagacgacctcagggccctgctgtgacttgacagtgggcgggctcgaccccgtacgc
tgctatgacttccgggttcgggcgtcgccccgggccgcgcactatggcctggaggcgcag
cctagcgagtggacagcggtgacaaggctttccggggcagcatccgcggcctcctgtacc
gcaagccccgccccatccccggccctggccccgcccctcctgcccctgggctgcggccta
gcagcgctgctgacactgtccctgctcctggccgccctgaggcttcgcagggtgaaagat
gcgctgctgccctgcgtccctgaccccagcggctccttccctggactctttgagaagcat
cacgggaacttccaggcctggattgcggacgcccaggccacagccccgccagccaggacc
gaggaggaagatgacctcatccacaccaaggctaagagggtggagcccgaggacggcacc
tccctctgcaccgtgccaaggccacccagcttcgagccaagggggccgggaggcggggcc
atggtgtcagtgggcggggccacgttcatggtgggcgacagcggctacatgaccctgtga

KEGG   Mus musculus (mouse): 60504
Entry
60504             CDS       T01002                                 

Gene name
Il21r, NILR
Definition
(RefSeq) interleukin 21 receptor
  KO
K05075  interleukin 21 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    60504 (Il21r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60504 (Il21r)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    60504 (Il21r)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    60504 (Il21r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    60504 (Il21r)
   04090 CD molecules [BR:mmu04090]
    60504 (Il21r)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL2 receptor family
   60504 (Il21r)
CD molecules [BR:mmu04090]
 Proteins
  60504 (Il21r)
SSDB
Motif
Pfam: IL4Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 60504
NCBI-ProteinID: NP_068687
MGI: 1890475
Ensembl: ENSMUSG00000030745
Vega: OTTMUSG00000058203
UniProt: Q9JHX3 Q3TAI3
Position
7; 7 F3
AA seq 529 aa
MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQD
QETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKP
APPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDS
RNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPHMLL
LLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLYREHSGNFKKWVNTPFTASS
IELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDGMSEPGHWCIIPLAAGQAVSA
YSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPAMNLDAGRESGPNSEDLLLVTD
PAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWTADPTWRTGSPGGGSESEAGSPP
GLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVRTPPPVDSGAQSS
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgccccggggcccagtggctgccttactcctgctgattctccatggagcttggagctgc
ctggacctcacttgctacactgactacctctggaccatcacctgtgtcctggagacacgg
agccccaaccccagcatactcagtctcacctggcaagatgaatatgaggaacttcaggac
caagagaccttctgcagcctacacaggtctggccacaacaccacacatatatggtacacg
tgccatatgcgcttgtctcaattcctgtccgatgaagttttcattgtcaatgtgacggac
cagtctggcaacaactcccaagagtgtggcagctttgtcctggctgagagcatcaaacca
gctccccccttgaacgtgactgtggccttctcaggacgctatgatatctcctgggactca
gcttatgacgaaccctccaactacgtgctgaggggcaagctacaatatgagctgcagtat
cggaacctcagagacccctatgctgtgaggccggtgaccaagctgatctcagtggactca
agaaacgtctctcttctccctgaagagttccacaaagattctagctaccagctgcaggtg
cgggcagcgcctcagccaggcacttcattcagggggacctggagtgagtggagtgacccc
gtcatctttcagacccaggctggggagcccgaggcaggctgggaccctcacatgctgctg
ctcctggctgtcttgatcattgtcctggttttcatgggtctgaagatccacctgccttgg
aggctatggaaaaagatatgggcaccagtgcccacccctgagagtttcttccagcccctg
tacagggagcacagcgggaacttcaagaaatgggttaatacccctttcacggcctccagc
atagagttggtgccacagagttccacaacaacatcagccttacatctgtcattgtatcca
gccaaggagaagaagttcccggggctgccgggtctggaagagcaactggagtgtgatgga
atgtctgagcctggtcactggtgcataatccccttggcagctggccaagcggtctcagcc
tacagtgaggagagagaccggccatatggtctggtgtccattgacacagtgactgtggga
gatgcagagggcctgtgtgtctggccctgtagctgtgaggatgatggctatccagccatg
aacctggatgctggccgagagtctggccctaattcagaggatctgctcttggtcacagac
cctgcttttctgtcttgcggctgtgtctcaggtagtggtctcaggcttggaggctcccca
ggcagcctactggacaggttgaggctgtcatttgcaaaggaaggggactggacagcagac
ccaacctggagaactgggtccccaggagggggctctgagagtgaagcaggttccccccct
ggtctggacatggacacatttgacagtggctttgcaggttcagactgtggcagccccgtg
gagactgatgaaggaccccctcgaagctatctccgccagtgggtggtcaggacccctcca
cctgtggacagtggagcccagagcagctag

DBGET integrated database retrieval system