KEGG   Mus musculus (mouse): 100043224
Entry
100043224         CDS       T01002                                 

Gene name
Gm4301
Definition
(RefSeq) predicted gene 4301
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: RRM_1 Neur_chan_memb TFIIA CPSF100_C DDHD HABP4_PAI-RBP1 SID-1_RNA_chan eIF-3_zeta Borrelia_P83 NPR3 Peptidase_U57 EOS1 SpoIIP MAJIN
Other DBs
NCBI-GeneID: 100043224
NCBI-ProteinID: NP_001160109
MGI: 3782481
Ensembl: ENSMUSG00000094314
Vega: OTTMUSG00000049691
UniProt: K9J7E2
Position
10 D1; 10
AA seq 289 aa
MTTMADKMDMSLEDILKLNKMQQGRLDRPDSRVKRGTGPKRYRPAFTHDGRNRLAPYCRP
KQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYD
RCGRSLGTAHVHFERKADALKAMREYNGAPLDGRPMNIHLVTSQIDRQGRPALNSDKGGM
TRNPGSGVLSGGGNKRWTLGGSQGRGRGTSRNSKLQQQQQQQQQQQQQQQQQEEQKHQKQ
QQQKQQQQQQKQGQNHQHQQQQKEKELQQLSVEELDAQLDAYQEMMDTS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgactaccatggctgacaaaatggacatgtcattggaagacatccttaagctgaacaag
atgcagcaaggacgtcttgacaggcctgattcccgggtgaagcgaggcactgggcctaag
aggtatcggccagctttcacccatgatggaaggaacaggctggcaccatactgcagacca
aaacaacttccagacaagtggcagcatgacctattcattggaggcttcaggggtcaaaac
cacgtggatactggtgggaagctgttcctgtcaaatctgcacttcggagtgtcagatgct
gatattcagctactctttgctgaatttggaacgttgaaaaaatctgctgtgcactatgat
cgctgtggacgaagtttagggacagcacatgtgcactttgaaaggaaagcagatgccctg
aaggctatgagagagtacaatggcgcccctttggatggccgccctatgaacatccacctt
gtcacctcacagattgatagacaaggaagacctgcactaaacagtgataagggcggcatg
acaagaaaccctggctctggagtattaagtggtggaggcaacaagagatggacacttgga
ggcagccagggaagagggagaggcaccagcaggaactcaaaactgcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcaagaggagcagaagcaccagaagcag
caacagcagaagcagcagcaacagcagcagaagcagggacagaatcaccagcaccagcag
cagcagaaggagaaggaactgcagcagctatctgtagaggagctggacgcccagctggat
gcttatcaggaaatgatggacaccagctaa

DBGET integrated database retrieval system