KEGG   Mus musculus (mouse): 100043292
Entry
100043292         CDS       T01002                                 

Gene name
Gm4340
Definition
(RefSeq) predicted gene 4340
  KO
K12881  THO complex subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu03015  mRNA surveillance pathway
mmu03040  Spliceosome
mmu05014  Amyotrophic lateral sclerosis
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100043292 (Gm4340)
  09122 Translation
   03013 RNA transport
    100043292 (Gm4340)
   03015 mRNA surveillance pathway
    100043292 (Gm4340)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100043292 (Gm4340)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100043292 (Gm4340)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    100043292 (Gm4340)
   03041 Spliceosome [BR:mmu03041]
    100043292 (Gm4340)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100043292 (Gm4340)
    TREX complex
     100043292 (Gm4340)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   EJC/TREX
    100043292 (Gm4340)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    100043292 (Gm4340)
SSDB
Motif
Pfam: RRM_1 DUF1645 TFIIA Anoctamin DUF2681 DUF4407 EOS1 DDHD Presenilin FoP_duplication
Other DBs
NCBI-GeneID: 100043292
NCBI-ProteinID: NP_001171006
MGI: 3782524
Ensembl: ENSMUSG00000090854
Vega: OTTMUSG00000042984
UniProt: L7N2C4
Position
10 D1; 10
AA seq 268 aa
MTTMADKMDMSLEDIIKLTKIQQRRHDRPDSRVNRGTGSKRYRPAFTHGGRNRLAPYCRP
KQLPDKWQHDLFIGGFRGQNHVDTGGKLFLSNLHFGVSDADIQLLFAEFGTLKKSAVHYD
RCGRSLGTAQVHFERKADALKAMREYNGAPLDGRPMNIQLATSQIDRQGRPAQSKNRGGM
TRNPGSGVLSGGGTKKWTLGGSQGRGRGTIRNSKLQQQQQQQKQKQQQQQQKQQQKQQQK
QQQKQQQQLSAEELDAQLDAYQEMMDTS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgactaccatggctgacaaaatggacatgtcattggaagacatcattaagctgaccaag
atccagcaaagacgtcatgacaggcctgattcccgggtgaatcgaggcactgggtctaag
aggtataggccagctttcacccatggtggaaggaacaggctggcaccatactgcagacca
aaacaacttccagacaagtggcagcatgacctgttcattggaggcttcaggggtcaaaac
cacgtggatactggtgggaagctcttcttgtcaaatctgcacttcggagtgtcagatgct
gatattcagctactctttgctgaatttggaacgttgaagaaatctgctgtgcactatgat
cgctgtggacgaagtttagggacagcacaggtgcactttgaaaggaaagcagatgccctg
aaggctatgagagagtacaatggcgcccctttggatggccgccctatgaacatccagctt
gccacctcacagattgatagacaaggaagacctgcacaaagcaaaaataggggcggcatg
acaagaaaccctggctctggagtattaagtggtggaggcaccaagaaatggacacttgga
ggcagccagggaagagggagaggcaccatcaggaactcaaaactgcagcaacagcagcag
cagcagaagcagaagcagcagcagcagcagcagaagcagcagcagaagcagcagcagaag
cagcagcagaagcagcagcagcagctatctgcagaggagctggatgcccagctggatgct
tatcaggaaatgatggacaccagctga

DBGET integrated database retrieval system