KEGG   Mus musculus (mouse): 100043314Help
Entry
100043314         CDS       T01002                                 

Gene name
Tigit, Vstm3
Definition
(RefSeq) T cell immunoreceptor with Ig and ITIM domains
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    100043314 (Tigit)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set ig Ig_6 Ig_3 I-set Ig_2
Motif
Other DBs
NCBI-GeneID: 100043314
NCBI-ProteinID: NP_001139797
MGI: 3642260
Ensembl: ENSMUSG00000071552
UniProt: A0A0B4J1G6
Position
16; 16 B4
AA seq 241 aa AA seqDB search
MHGWLLLVWVQGLIQAAFLATGATAGTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDW
KQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYK
GRIFLKVQESSVAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKKSIRMHSIESGLGRTE
AEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKT
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcatggctggctgctcctggtctgggtccaggggctgatacaggctgccttcctcgct
acaggagccacagcaggcacgatagatacaaagaggaacatctctgcagaggaaggtggc
tctgtcatcttacagtgtcacttctcctctgacacagctgaagtgacccaagtcgactgg
aagcagcaggaccagcttctggccatttatagtgttgacctggggtggcatgtcgcttca
gtcttcagtgatcgggtggtcccaggccccagcctaggcctcaccttccagtctctgaca
atgaatgacacgggagagtacttctgtacctatcatacgtatcctggtgggatttacaag
gggagaatattcctgaaggtccaagaaagctcagtggctcagttccagactgccccgctt
ggaggaaccatggctgctgtgctgggactcatttgcttaatggtcacaggagtgactgta
ctggctagaaagaagtctattagaatgcattctatagaaagtggccttgggagaacagaa
gcggagccacaggaatggaacctgaggagtctctcatcccctggaagccctgtccagaca
caaactgcccctgctggtccctgtggagagcaggcagaagatgactatgctgacccacag
gaatactttaatgtcctgagctacagaagcctagagagcttcattgctgtatcgaagact
ggctaa

DBGET integrated database retrieval system