KEGG   Mus musculus (mouse): 100043684
Entry
100043684         CDS       T01002                                 

Gene name
Amy2a4, Amy2, Amy2a, PA, mAmy2-, mAmy2-3
Definition
(RefSeq) amylase 2a4
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100043684 (Amy2a4)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100043684 (Amy2a4)
   04972 Pancreatic secretion
    100043684 (Amy2a4)
   04973 Carbohydrate digestion and absorption
    100043684 (Amy2a4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100043684 (Amy2a4)
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C LSR
Other DBs
NCBI-GeneID: 100043684
NCBI-ProteinID: NP_001153622
MGI: 3711258
Ensembl: ENSMUSG00000096770
Vega: OTTMUSG00000022433
UniProt: P00688
Position
3 F3; 3
AA seq 508 aa
MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA
GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDL
ALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNF
QNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN
WWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacat
acttcagatgggaggactgctattgtccacctgttcgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccaccc
aatgaaaacgttgtagttcataacccatcaagaccttggtgggaaagataccaaccaatc
agctataaaatctgcacaaggtctggaaatgaagatgaattcagagacatggtgacaagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggcgca
ggcaatcctgcaggaacaagcagtacctgtggaagttacctcaatccaaataacagggaa
ttcccagcagttccatactctgcttgggactttaacgataataaatgtaatggagaaatt
gataactacaatgatgcttatcaggtcagaaattgtcgtctgactggccttctggatctt
gcacttgagaaagattatgttcgtaccaaggtggctgactatatgaaccatctcattgac
attggagtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactgcataatctcaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatctgggtggtgaggcaattaaaggtagtgagtacttt
ggaaatggccgtgtgacagaattcaagtatggtgcaaaacttggcacagttatccgcaag
tggaatggcgagaagatgtcctatttaaagaactggggagaaggttggggtttggtgcct
tctgacagagcccttgtgtttgtggacaaccatgataatcagcgaggacatggtgctgga
ggatcatccatcctgacattctgggatgctagaatgtataaaatggctgtcggatttatg
ttggctcatccttatggattcacaagagtaatgtcaagttaccgttggaatagaaatttc
cagaatggaaaagatcagaatgactggattggaccacccaataacaatggagtaacaaaa
gaagtgaccattaatgcagacactacttgtggcaatgactgggtctgtgaacacagatgg
cgtcaaatcaggaacatggttgccttcaggaatgtggtcaatggtcagcctttttcaaac
tggtgggataataacagcaaccaagtagcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcagccactttacagactggtcttcctgctggcaca
tactgtgatgtcatctctggagataaggtcgatggcaattgcactggacttagagtgaat
gttggcagtgatggcaaagctcacttttccattagtaactctgctgaggacccatttatt
gcaatccatgctgactcaaaattgtaa

KEGG   Mus musculus (mouse): 100043686
Entry
100043686         CDS       T01002                                 

Gene name
Amy2a3, Amy2, Amy2a, PA, mAmy2-, mAmy2-4
Definition
(RefSeq) amylase 2a3
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100043686 (Amy2a3)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100043686 (Amy2a3)
   04972 Pancreatic secretion
    100043686 (Amy2a3)
   04973 Carbohydrate digestion and absorption
    100043686 (Amy2a3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100043686 (Amy2a3)
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C LSR
Other DBs
NCBI-GeneID: 100043686
NCBI-ProteinID: NP_001153623
MGI: 3714985
Ensembl: ENSMUSG00000093931
Vega: OTTMUSG00000022430
UniProt: P00688
Position
3 F3; 3
AA seq 508 aa
MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA
GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDL
ALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNF
QNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN
WWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacat
acttcagatgggaggactgctattgtccacctgttcgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccaccc
aatgaaaacgttgtagttcataacccatcaagaccttggtgggaaagataccaaccaatc
agctataaaatctgcacaaggtctggaaatgaagatgaattcagagacatggtgacaagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggcgca
ggcaatcctgcaggaacaagcagtacctgtggaagttacctcaatccaaataacagggaa
ttcccagcagttccatactctgcttgggactttaacgataataaatgtaatggagaaatt
gataactacaatgatgcttatcaggtcagaaattgtcgtctgactggccttctggatctt
gcacttgagaaagattatgttcgtaccaaggtggctgactatatgaaccatctcattgac
attggagtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactgcataatctcaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatctgggtggtgaggcaattaaaggtagtgagtacttt
ggaaatggccgtgtgacagaattcaagtatggtgcaaaacttggcacagttatccgcaag
tggaatggcgagaagatgtcctatttaaagaactggggagaaggttggggtttggtgcct
tctgacagagcccttgtgtttgtggacaaccatgataatcagcgaggacatggtgctgga
ggatcatccatcctgacattctgggatgctagaatgtataaaatggctgtcggatttatg
ttggctcatccttatggattcacaagagtaatgtcaagttaccgttggaatagaaatttc
cagaatggaaaagatcagaatgactggattggaccacccaataacaatggagtaacaaaa
gaagtgaccattaatgcagacactacttgtggcaatgactgggtctgtgaacacagatgg
cgtcaaatcaggaacatggttgccttcaggaatgtggtcaatggtcagcctttttcaaac
tggtgggataataacagcaaccaagtagcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcagccactttacagactggtcttcctgctggcaca
tactgtgatgtcatctctggagataaggtcgatggcaattgcactggacttagagtgaat
gttggcagtgatggcaaagctcacttttccattagtaactctgctgaggacccatttatt
gcaatccatgctgactcaaaattgtaa

KEGG   Mus musculus (mouse): 100043688
Entry
100043688         CDS       T01002                                 

Gene name
Amy2a2, Amy2, Amy2a, PA, mAmy2-, mAmy2-5
Definition
(RefSeq) amylase 2a2
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100043688 (Amy2a2)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    100043688 (Amy2a2)
   04972 Pancreatic secretion
    100043688 (Amy2a2)
   04973 Carbohydrate digestion and absorption
    100043688 (Amy2a2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100043688 (Amy2a2)
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C LSR
Other DBs
NCBI-GeneID: 100043688
NCBI-ProteinID: NP_001153624
MGI: 3711220
Ensembl: ENSMUSG00000096569
Vega: OTTMUSG00000022431
UniProt: P00688
Position
3 F3; 3
AA seq 508 aa
MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA
GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDL
ALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNF
QNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN
WWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacat
acttcagatgggaggactgctattgtccacctgttcgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccaccc
aatgaaaacgttgtagttcataacccatcaagaccttggtgggaaagataccaaccaatc
agctataaaatctgcacaaggtctggaaatgaagatgaattcagagacatggtgacaagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggcgca
ggcaatcctgcaggaacaagcagtacctgtggaagttacctcaatccaaataacagggaa
ttcccagcagttccatactctgcttgggactttaacgataataaatgtaatggagaaatt
gataactacaatgatgcttatcaggtcagaaattgtcgtctgactggccttctggatctt
gcacttgagaaagattatgttcgtaccaaggtggctgactatatgaaccatctcattgac
attggagtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactgcataatctcaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatctgggtggtgaggcaattaaaggtagtgagtacttt
ggaaatggccgtgtgacagaattcaagtatggtgcaaaacttggcacagttatccgcaag
tggaatggcgagaagatgtcctatttaaagaactggggagaaggttggggtttggtgcct
tctgacagagcccttgtgtttgtggacaaccatgataatcagcgaggacatggtgctgga
ggatcatccatcctgacattctgggatgctagaatgtataaaatggctgtcggatttatg
ttggctcatccttatggattcacaagagtaatgtcaagttaccgttggaatagaaatttc
cagaatggaaaagatcagaatgactggattggaccacccaataacaatggagtaacaaaa
gaagtgaccattaatgcagacactacttgtggcaatgactgggtctgtgaacacagatgg
cgtcaaatcaggaacatggttgccttcaggaatgtggtcaatggtcagcctttttcaaac
tggtgggataataacagcaaccaagtagcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcagccactttacagactggtcttcctgctggcaca
tactgtgatgtcatctctggagataaggtcgatggcaattgcactggacttagagtgaat
gttggcagtgatggcaaagctcacttttccattagtaactctgctgaggacccatttatt
gcaatccatgctgactcaaaattgtaa

KEGG   Mus musculus (mouse): 109959
Entry
109959            CDS       T01002                                 

Gene name
Amy2a5, 1810008N23Rik, Amy, Amy-, Amy-2, Amy2, mAmy2-, mAmy2-2
Definition
(RefSeq) amylase 2a5
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109959 (Amy2a5)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    109959 (Amy2a5)
   04972 Pancreatic secretion
    109959 (Amy2a5)
   04973 Carbohydrate digestion and absorption
    109959 (Amy2a5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     109959 (Amy2a5)
SSDB
Motif
Pfam: Alpha-amylase Alpha-amylase_C LSR
Other DBs
NCBI-GeneID: 109959
NCBI-ProteinID: NP_001036176
MGI: 88020
Ensembl: ENSMUSG00000074268
Vega: OTTMUSG00000022434
UniProt: P00688
Position
3 F3; 3 49.35 cM
AA seq 508 aa
MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGA
GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDL
ALEKDYVRTKVADYMNHLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRP
FIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRWNRNF
QNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFSN
WWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCTGLRVN
VGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacat
acttcagatgggaggactgctattgtccacctgttcgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccaccc
aatgaaaacgttgtagttcataacccatcaagaccttggtgggaaagataccaaccaatc
agctataaaatctgcacaaggtctggaaatgaagatgaattcagagacatggtgacaagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggcgca
ggcaatcctgcaggaacaagcagtacctgtggaagttacctcaatccaaataacagggaa
ttcccagcagttccatactctgcttgggactttaacgataataaatgtaatggagaaatt
gataactacaatgatgcttatcaggtcagaaattgtcgtctgactggccttctggatctt
gcacttgagaaagattatgttcgtaccaaggtggctgactatatgaaccatctcattgac
attggagtagcagggttcagacttgatgctgctaagcacatgtggcctggagacataaag
gcagttttggacaaactgcataatctcaatacaaaatggttctcccaaggaagcagacct
ttcattttccaagaggtcattgatctgggtggtgaggcaattaaaggtagtgagtacttt
ggaaatggccgtgtgacagaattcaagtatggtgcaaaacttggcacagttatccgcaag
tggaatggcgagaagatgtcctatttaaagaactggggagaaggttggggtttggtgcct
tctgacagagcccttgtgtttgtggacaaccatgataatcagcgaggacatggtgctgga
ggatcatccatcctgacattctgggatgctagaatgtataaaatggctgtcggatttatg
ttggctcatccttatggattcacaagagtaatgtcaagttaccgttggaatagaaatttc
cagaatggaaaagatcagaatgactggattggaccacccaataacaatggagtaacaaaa
gaagtgaccattaatgcagacactacttgtggcaatgactgggtctgtgaacacagatgg
cgtcaaatcaggaacatggttgccttcaggaatgtggtcaatggtcagcctttttcaaac
tggtgggataataacagcaaccaagtagcttttagcagaggaaacagaggattcattgtc
tttaacaatgatgactgggctttgtcagccactttacagactggtcttcctgctggcaca
tactgtgatgtcatctctggagataaggtcgatggcaattgcactggacttagagtgaat
gttggcagtgatggcaaagctcacttttccattagtaactctgctgaggacccatttatt
gcaatccatgctgactcaaaattgtaa

KEGG   Mus musculus (mouse): 11722
Entry
11722             CDS       T01002                                 

Gene name
Amy1, Amy-, Amy-1, Amy1a, C030014B17Rik
Definition
(RefSeq) amylase 1, salivary
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    11722 (Amy1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    11722 (Amy1)
   04972 Pancreatic secretion
    11722 (Amy1)
   04973 Carbohydrate digestion and absorption
    11722 (Amy1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     11722 (Amy1)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Other DBs
NCBI-GeneID: 11722
NCBI-ProteinID: NP_001103975
MGI: 88019
Ensembl: ENSMUSG00000074264
Vega: OTTMUSG00000022392
UniProt: P00687
Position
3 F3; 3 49.35 cM
AA seq 511 aa
MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECERYLAPNGFAGVQVSPP
NENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGV
GAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGIENYQDAAQVRDCRLSGL
LDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNTKWFSQG
SRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVMRKWDGEKMSYLKNWGEGWG
LMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYYWP
RNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWICEHRWRQIRNMVAFRNVVNGQP
FANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTGLPAGTYCDVISGDKVDGNCTGI
KVYVGNDGKAHFSISNSAEDPFIAIHAESKI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaaattcttcctgctgctttccctcattggattctgctgggcccaatatgacccacat
actcaatatggacgaactgctattgtccacctgtttgagtggcgctgggttgatattgct
aaggaatgtgagagatacttagctcctaatggatttgcaggtgtgcaggtctctccaccc
aatgaaaacatcgtagtccacagcccttcaagaccatggtgggaaagatatcaaccaatt
agctacaaaatatgttccaggtctggaaatgaagatgaattcagggacatggtgaacagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggagtg
ggggctcaagctggacaaagcagtacatgtggaagttatttcaacccaaataacagggac
tttcctggagttccctattctggttttgactttaatgatggaaaatgtagaactgcaagt
ggaggtatcgagaactaccaagatgctgctcaggtcagagattgtcgtctgtctggcctt
ctggatcttgcacttgagaaagattatgttcgaaccaaggtggctgactatatgaaccat
ctcattgacattggcgtagcagggttcagacttgatgcttctaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctcaatacaaaatggttctcccaagga
agcagacctttcattttccaagaggtgattgatctgggtggtgaggcagtgtcaagtaat
gagtattttggaaatggccgtgtgacagaattcaaatatggagcaaaattgggcaaagtt
atgcgcaagtgggatggagaaaagatgtcctacttaaagaactggggagaaggttggggt
ttgatgccttctgacagagcccttgtgtttgtggacaaccatgacaatcagcgaggacat
ggtgctgggggagcatccatcttgacattctgggatgctagactctataaaatggctgtt
ggctttatgttggctcatccttatggtttcacacgggtgatgtcaagttactattggcca
agaaatttccagaatggaaaagatgtcaatgactgggttggaccaccaaataacaatgga
aaaaccaaagaagtgagcattaacccagacagcacttgtggcaatgactggatctgtgaa
catcgatggcgtcaaataaggaacatggttgccttcagaaatgtcgtcaatggtcagcct
tttgcaaactggtgggataatgacagcaaccaggtagcttttggcagaggaaacaaagga
ttcattgtctttaacaatgatgactgggctttgtcagaaactttacagactggtcttcct
gctggcacatactgtgatgtcatttctggagataaagtcgatggcaattgcactggaata
aaagtctatgttggcaatgatggcaaagctcacttttctattagtaactctgccgaagac
ccatttattgcaatccatgcagagtcaaaaatataa

KEGG   Mus musculus (mouse): 545562
Entry
545562            CDS       T01002                                 

Gene name
Amy2b, Amy-, Amy-X, Amy2, Amy2-, Amy2-2, Amy2a, PA, mAmy2-, mAmy2-1
Definition
(RefSeq) amylase 2b
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    545562 (Amy2b)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    545562 (Amy2b)
   04972 Pancreatic secretion
    545562 (Amy2b)
   04973 Carbohydrate digestion and absorption
    545562 (Amy2b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     545562 (Amy2b)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Other DBs
NCBI-GeneID: 545562
NCBI-ProteinID: NP_001177332
MGI: 104547
Ensembl: ENSMUSG00000083079
Position
3 F3; 3 49.35 cM
AA seq 453 aa
MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPKGFGGVQVSPP
NENIVIHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTRCNNVGVRIYVDAVINHMCGS
GNPAGTSSTCGSYLNPNNREFPAVPYSAWDFNDNKCNGEISNYNDAYQVRNCRLSGLLDL
ALEKDYVRTKVIDLGGEAIKGSEYFGNGRVTEFKFGAKLGTVIRKWNGEKMSYLKNWGEG
WGLVPSDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRVMSSYR
WNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRWRQIRNMVAFRNVVNG
QPFANWWDNNSNQVAFSRGNRGFIVFNNDDWALSATLQTGLPAGTYCDVISGDKVDGNCT
GLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagttcgttctgctgctttccctcattgggttctgctgggctcaatatgacccacat
acttcagatgggaggactgctattgtccacctgttcgagtggcgctgggttgatattgcc
aaggaatgtgagcgatacttagctcctaagggatttggaggggtgcaggtctctccaccc
aatgaaaatattgtaattcataacccatcaaggccttggtgggaaagatatcaaccaatc
agctacaaaatttgcacaaggtctggaaatgaagatgaattcagagacatggtgacaagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggctca
ggcaatcctgcaggaacaagcagtacctgtggaagttacctcaatccaaataacagggaa
ttcccagcagttccatactctgcttgggactttaacgataataaatgtaatggagaaatt
agtaactacaatgatgcttatcaggtcagaaattgtcgtctgtctggccttctggatctt
gcacttgagaaagattatgttcgtaccaaggttattgatctgggtggtgaggcaattaaa
ggtagtgagtactttggaaatggccgtgtaacagaattcaagtttggtgcaaaacttggc
acagttatccgcaagtggaatggagagaagatgtcctatttaaagaactggggagaaggt
tggggtttggtgccttctgacagagcccttgtgtttgtggacaaccatgacaatcagcga
ggacatggtgctggaggatcatccatcctgacattctgggatgctagaatgtacaaaatg
gctgttggatttatgttggctcatccttatggattcacaagagtaatgtcaagttaccgt
tggaatagaaatttccagaatggaaaagatcagaatgactggattggaccacctaataac
aatggagtaacaaaagaagtgaccattaatgcagacactacttgtggcaatgactgggtc
tgtgaacatagatggcgtcaaataaggaacatggttgccttcaggaatgtagtcaatggt
cagccttttgcaaactggtgggataataacagcaaccaagtagcttttagcagaggaaac
agaggcttcattgtctttaacaatgatgactgggctttgtcagccactttacagactggt
cttcctgctggcacatactgtgatgtcatctctggagataaggtcgatggcaattgcact
ggacttaaagtaaatgttggcagtgatggtaaagctcacttttccattagtaactctgct
gaggacccatttattgcaatccatgctgactcaaaactgtaa

DBGET integrated database retrieval system