KEGG   Mus musculus (mouse): 100046078
Entry
100046078         CDS       T01002                                 

Gene name
Gm15266
Definition
(RefSeq) predicted gene 15266
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    100046078 (Gm15266)
   04141 Protein processing in endoplasmic reticulum
    100046078 (Gm15266)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100046078 (Gm15266)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    100046078 (Gm15266)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   100046078 (Gm15266)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-GeneID: 100046078
NCBI-ProteinID: XP_003085350
MGI: 3705867
Position
X; X F3
AA seq 68 aa
MDQVMQFVEPSQRFVKDSIWLVKRCTNLDRKEFQKIAMATTIGFAIMEFIGFFVKLIHIP
INNITMGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgttgagccaagtcagcggtttgtaaaggactcaatttgg
ctggttaaaagatgtaccaatctcgacagaaaagaattccagaagattgccatggccaca
acgataggatttgctatcatggaattcattggcttctttgtgaaactgatccatatccct
attaataacattactatgggtggctga

KEGG   Mus musculus (mouse): 102632470
Entry
102632470         CDS       T01002                                 

Gene name
Gm30534
Definition
(RefSeq) predicted gene, 30534
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    102632470 (Gm30534)
   04141 Protein processing in endoplasmic reticulum
    102632470 (Gm30534)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102632470 (Gm30534)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    102632470 (Gm30534)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   102632470 (Gm30534)
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-GeneID: 102632470
NCBI-ProteinID: XP_006513019
MGI: 5589693
Position
10 A4; 10
AA seq 68 aa
MDQVMQFIEPSWQFVKDSIHLVKRCTKPDRKEFQEIAMATAIGFVIMGFIGFFAKRIHIP
INNVIVGC
NT seq 207 nt   +upstreamnt  +downstreamnt
atggaccaggtaatgcagtttatagagccaagttggcagtttgtaaaggactcaattcat
ctggttaaaagatgcaccaaacctgacagaaaagaattccaggagattgccatggccaca
gcaataggatttgttatcatgggattcattggcttctttgcgaaacggatccatatccct
attaataacgttattgtgggttgctga

KEGG   Mus musculus (mouse): 20335
Entry
20335             CDS       T01002                                 

Gene name
Sec61g
Definition
(RefSeq) SEC61, gamma subunit
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    20335 (Sec61g)
   04141 Protein processing in endoplasmic reticulum
    20335 (Sec61g)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    20335 (Sec61g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    20335 (Sec61g)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   20335 (Sec61g)
SSDB
Motif
Pfam: SecE Pho88
Other DBs
NCBI-GeneID: 20335
NCBI-ProteinID: NP_001103441
MGI: 1202066
Ensembl: ENSMUSG00000078974
Vega: OTTMUSG00000005181
UniProt: P60060 Q5SWJ8
Position
11; 11 A2
AA seq 68 aa
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIP
INNIIVGG
NT seq 207 nt   +upstreamnt  +downstreamnt
atggatcaggtaatgcagtttgtggagcccagccggcagtttgtaaaggactcaattcgg
ctggttaaaagatgcaccaaacccgacagaaaagaattccagaagattgccatggctaca
gctataggatttgctatcatgggattcattggcttcttcgtgaaactgatccatataccc
attaataacattattgtgggtggctga

KEGG   Mus musculus (mouse): 53421
Entry
53421             CDS       T01002                                 

Gene name
Sec61a1, AA408394, AA410007, Sec6, Sec61a
Definition
(RefSeq) Sec61 alpha 1 subunit (S. cerevisiae)
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    53421 (Sec61a1)
   04141 Protein processing in endoplasmic reticulum
    53421 (Sec61a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    53421 (Sec61a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    53421 (Sec61a1)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   53421 (Sec61a1)
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 53421
NCBI-ProteinID: NP_058602
MGI: 1858417
Ensembl: ENSMUSG00000030082
Vega: OTTMUSG00000023092
UniProt: P61620
Position
6; 6 D1
AA seq 476 aa
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgatcaaatttctggaagtcatcaagccattctgtgtcatcttgccggaaattcag
aagccagagagaaagattcagtttaaggagaaagttctgtggacagccatcaccctcttc
atcttcttagtatgctgtcagatccccctgtttggcatcatgtcttcagactcagctgac
ccgttctactggatgcgagtgattctggcctctaacagaggtaccttaatggagctgggc
atctctcctattgtcacctccggtcttatcatgcagctcttagctggtgccaagataatt
gaagttggggacaccccgaaagaccgagctctcttcaatggagcccagaagttgtttgga
atgatcattactatcggtcagtccattgtgtatgtgatgacgggcatgtacggggaccct
tcggagatgggtgctggaatctgcctgctgatcaccattcagctctttgttgctggctta
attgtcctacttttggatgaacttctgcaaaaagggtacggcttgggctctggcatttct
ctcttcattgcgactaacatctgtgagaccattgtgtggaaggcattcagccccaccact
gtcaacactggccgagggatggaattcgaaggcgccatcatagcgctattccacctgctg
gccacccgcacagacaaggtccgagcccttcgagaggcattctaccgccagaacctcccc
aacctcatgaacctgattgccaccatcttcgtctttgccgttgtcatctatttccagggc
ttccgagtggaccttccaatcaagtcggcgcgttaccgaggccagtacaacacctatccc
atcaagctcttctacacctccaacatccccatcatcttgcagtctgctctggtgtccaac
ctgtatgtcatctcccagatgctgtcagcacgcttcagtggcaacctgctggttagcctg
ctgggcacctggtcggatacatcatctgggggcccagcccgagcttaccccgttggtggc
ctgtgttactacctgtctcctccggaatcgttcggctcagtgctggaggaccctgtccat
gcggtcgtgtacatcgtgttcatgctgggctcctgtgcattcttctccaaaacatggatc
gaagtctcaggttcttctgccaaagatgttgcaaagcagctgaaggagcagcagatggtg
atgaggggccacagggagacctccatggtgcatgagctcaaccggtacatccccacagcc
gcagcctttggtgggctgtgcattggggccctctctgtcctggctgacttcctgggtgct
atcgggtctggaactgggatcctgcttgcggtcaccatcatctaccagtactttgagatc
ttcgtcaaggaacagagcgaggtgggcagcatgggagcccttctcttctga

KEGG   Mus musculus (mouse): 57743
Entry
57743             CDS       T01002                                 

Gene name
Sec61a2
Definition
(RefSeq) Sec61, alpha subunit 2 (S. cerevisiae)
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    57743 (Sec61a2)
   04141 Protein processing in endoplasmic reticulum
    57743 (Sec61a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    57743 (Sec61a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    57743 (Sec61a2)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   57743 (Sec61a2)
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 57743
NCBI-ProteinID: NP_067280
MGI: 1931071
Ensembl: ENSMUSG00000025816
Vega: OTTMUSG00000010876
UniProt: Q9JLR1
Position
2; 2 A1
AA seq 476 aa
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggcatcaagtttttagaagttattaaacctttctgtgcagttctaccagaaattcag
aagcctgaaaggaaaattcagtttagagagaaggtactatggactgctataacactcttc
attttcttagtatgctgtcagattccgctgtttgggatcatgtcatcggactctgcagat
cccttctactggatgagagttattcttgcatccaacagaggaacattgatggaattgggt
atttccccaattgtaacgtctggtttgattatgcagttgttagctggagccaaaatcatt
gaagttggagacacacccaaagatagagctctgttcaatggagcccagaaattatttggt
atgatcattaccattgggcaagccattgtgtatgtcatgacggggatgtacggggaccct
gcggaaatgggtgctgggatctgtctccttatcattattcagttgtttgttgctggtttg
attgtgctgctgttagatgagctgctacagaagggttacggcttggggtctgggatttcc
ctctttattgccaccaacatctgtgaaaccattgtctggaaggcctttagtcccactacc
attaacactggcagaggtacggagtttgaaggtgcagtcatagctctgtttcatttgctg
gccaccaggacagacaaggtgcgagccttgagggaggctttctataggcagaacctcccc
aacctcatgaacctcatcgccacagtgttcgtgtttgctgtcgtcatctattttcagggg
tttcgtgttgacttgcccattaagtcggcacggtatcgtggacagtacagtagctatcct
atcaagctcttctacacgtcgaatattcccataatcctccagtctgccctagtttcaaac
ttgtacgtcatttcccagatgctgtctgttcgatttagtggcaacttcttagtaaactta
ctaggacagtgggccgatgtcagtgggggagggcctgctcgctcctaccctgttggcggc
ctttgttactatctgtctcctcctgagtctatgggagccatatttgaggatcctgttcat
gtagttgtatatattatcttcatgttggggtcatgtgcattcttttctaagacgtggata
gaagtttctggttcttcagccaaagatgtggccaagcaacttaaagaacagcagatggtg
atgaggggtcacagagatacctccatggtccatgagctgaacaggtacatccccacagca
gctgcctttgggggtctgtgcatcggtgccctgtcagtactagcagacttccttggggcc
attggctctggtactggaattctgcttgcagtcactattatttatcagtattttgaaata
tttgttaaggaacaggctgaagttggtggaatgggtgctttgtttttctaa

KEGG   Mus musculus (mouse): 66212
Entry
66212             CDS       T01002                                 

Gene name
Sec61b, 1190006C12Rik, AI326121, AW122942
Definition
(RefSeq) Sec61 beta subunit
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    66212 (Sec61b)
   04141 Protein processing in endoplasmic reticulum
    66212 (Sec61b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    66212 (Sec61b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    66212 (Sec61b)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   66212 (Sec61b)
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 66212
NCBI-ProteinID: NP_077133
MGI: 1913462
Ensembl: ENSMUSG00000053317
Vega: OTTMUSG00000006799
UniProt: Q9CQS8
Position
4; 4 B1
AA seq 96 aa
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS
NT seq 291 nt   +upstreamnt  +downstreamnt
atgccgggtccaacgcccagtggcaccaacgtgggctcctctggccgctctcccagcaaa
gcggtggccgcacgggctgcgggatccactgttcggcagagaaaaaatgccagctgtggg
acccggagcgcaggccgcaccacctctgcagggactggggggatgtggcgattctacacg
gaagattccccagggctcaaagtgggccctgtcccagtgctggtgatgagtcttctgttc
atcgctgctgtatttatgctgcacatttggggcaagtacacgcgatcatag

DBGET integrated database retrieval system