KEGG   Mus musculus (mouse): 100048658Help
Entry
100048658         CDS       T01002                                 

Gene name
Ddx43
Definition
(RefSeq) DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
  KO
K17043  ATP-dependent RNA helicase DDX43 [EC:3.6.4.13]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    100048658 (Ddx43)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100048658 (Ddx43)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    100048658 (Ddx43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C KH_1 MOEP19 KH_2 KH_5 ResIII baeRF_family12
Motif
Other DBs
NCBI-GeneID: 100048658
NCBI-ProteinID: NP_001177973
MGI: 3642857
Ensembl: ENSMUSG00000070291
Vega: OTTMUSG00000019690
UniProt: D3Z6P9
Position
9; 9 E1
AA seq 646 aa AA seqDB search
MSRREPAANASSSGVAPRRSSTGSRGADRTATEETNRRGRVGSRGAGGGWREPAGAAEAT
AAGRREPPLCFGVKNDVVGAVIGRGGSKIREIQNTTNTRIQVIKGNPEAEIKIFGNKAMQ
TKAKTVIDNVVKKQQNYIPGQRVGIIAFQPTVGADTSTSESVTDDQPLIDWDQIREDALK
WEKKKWADLPPIKKNFYIESATTSSMSQVQIDNWRKENFNITCDDLKDGEKRPIPNPICK
FEDAFQSYPEVMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLSYLMPGFI
HLDSQPLAREQRNGPGMLVLTPTRELALQVEAECSKYSYGDLKSVCVYGGGDRDGQIQDV
SKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLDEADKMLDMGFEPQIMKILLDVRPDRQ
TIMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLE
NMSPKDKVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILI
ATDLASRGLDVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRVATEL
INILERANQNIPEELVLMAERYKANKLKREMEKKMGRPQGKPQKFY
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcgggaacccgcagccaacgcttcctcctcgggcgttgctccccggcgaagc
tcgaccgggtcccggggcgccgaccggacagcgacggaggagacgaaccggagaggccgg
gtcggtagcaggggtgcgggcggcggctggagagagcccgccggggccgccgaggctacg
gccgccggccgccgcgaaccgccgctctgcttcggggtgaagaacgatgtggtgggcgcg
gtgataggtcgtggtgggtcaaaaattagagaaatccaaaatacaacgaacactaggata
caggtaataaaaggaaatcctgaggcagaaatcaaaatttttggtaataaagccatgcaa
acaaaagcaaaaacagtgatagataatgttgttaaaaaacaacaaaattacattccagga
caaagagttggtattattgcattccaacctaccgttggagcagataccagcacaagtgag
agtgtaacagacgatcagccattgatagattgggatcaaattcgagaagatgctttgaaa
tgggaaaagaaaaagtgggcagatttacctccaattaagaaaaacttttacatagagtca
gcaacgacaagctcaatgtcacaagtgcaaatagacaactggaggaaagaaaattttaat
ataacatgtgatgacttgaaagatggtgagaagcgtcctatccccaaccctatatgtaaa
tttgaagatgcctttcaaagttacccagaagtaatggaaaacattaaaagagcaggcttt
caaaaacctacaccgattcagtcacaggcatggccaatagttctacaaggaatagatctt
attggagtagcacaaactggaacagggaagacactgtcctatttaatgcctggatttatt
catctagactctcaaccactagctagagaacaaagaaatgggcctggcatgttagttctt
acgcccacccgggaattagcccttcaagtagaagctgaatgttctaaatattcatatggt
gatcttaaaagtgtttgtgtatatggtggtggtgatagagatggacaaatacaagatgtt
tcaaaaggtgtagacatcattattgcaactcctggaagattgaatgacctacaaatgaat
aactttgtcaatctgaaaagtgtaacctatttggttttagatgaagcagacaagatgctg
gacatgggatttgaaccccagataatgaagattttgttagatgtacgcccagaccggcag
actattatgacaagcgctacttggccatatgccgtccgccgtcttgcacaatcttatttg
aaagaaccaatgattgtctatgttggtactttggatctagttgctgtaagtacagtgaaa
caaaatataatcattaccacagaagaagagaaacgaactcatatccagaccttcctcgag
aatatgtcacctaaagacaaagtcattgtctttgtcagcagaaaagccgttgctgatcac
ttatcaagtgatctgattctccgacacatatcagtggagtctctgcacggcaacagagaa
cagagtgaccgagagaaagcgttagagaactttaagacaggtaaagtgagaatacttatt
gctactgacttggcatctcgaggtcttgatgtccatgatatcactcatgtctacaattat
gattttccacggaacattgaagaatatgtacacagagtagggcgcactgggagagcaggg
cgcactggaatgtcaattacccttatcacaagaaatgattggagggttgccactgaattg
attaatattctagaaagagcaaatcagaatatcccagaggaacttgtcttaatggctgag
agatacaaagcaaataaactaaaaagagagatggaaaaaaaaatgggaagacctcaagga
aagccccagaagttttactaa

DBGET integrated database retrieval system