KEGG   Mus musculus (mouse): 100087
Entry
100087            CDS       T01002                                 

Symbol
Kti12, 1110001A12Rik, AI326810, AU014758
Name
(RefSeq) KTI12 homolog, chromatin associated
  KO
K15456  protein KTI12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    100087 (Kti12)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Elongator related proteins
    100087 (Kti12)
SSDB
Motif
Pfam: KTI12 AAA_33 AAA_18 APS_kinase
Other DBs
NCBI-GeneID: 100087
NCBI-ProteinID: NP_083847
MGI: 1923547
Ensembl: ENSMUSG00000073775
Vega: OTTMUSG00000008233
UniProt: Q9D1R2
Position
4; 4 C7
AA seq 351 aa
MPLVVVCGLPSSGKSQRTEELRRALASEGRAVYVVDDASVLGAQDPTVYGDSAGEKALRA
ALRAAVERRLSRQDVVILDSVNYIKGFRYELYCLARAARTPLCLLYCVRPNWPSRELREA
SASENRDLAVSVSWRPRAETGGKSQAAGAVEEQRATSPVANGGVLAAVSKELDPEEILPS
NPSAVMTPGSEKSAEPASCAFPPEVLESLALRFESPDSRNRWDRPLFTVVGLEEPLPLAE
IRSALFENRAPPPHQSTQSQPLASGSFLHQLDQATSQVLTAVMEAQKSAVPGDFLKLPGT
TEPLRFTRPLTLAELSRLRRQFISYTKMHPNNENLPQLANMFLQYLNQSLH
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgccgctcgtcgtggtttgcgggctgccgtccagcggcaagagccagcggacggaggag
ctccgtcgggcgctggccagcgagggccgcgcggtgtatgtggtggacgatgcttcggtg
ctgggcgcgcaggacccgactgtgtacggcgactccgctggtgagaaggctctgcgggct
gcgctgcgggctgcggtggagcggcgcctgagccggcaggacgtggtcatcctggactcg
gtgaactacatcaagggcttccgctacgagctgtactgcctcgcccgggccgcgcgcacg
ccgctctgcttactttactgcgtgcggccgaactggccgagccgcgagcttcgggaggct
tccgcctccgagaaccgggacctggctgtcagcgtgagctggagaccgcgggccgagacc
ggcgggaagtctcaggcggctggcgctgtggaggaacagcgcgccaccagccccgtagcc
aacgggggagttctggccgctgtctcaaaggaactggatccagaggaaatcctgccatca
aacccttccgctgtaatgaccccggggtccgagaaatctgcagagcctgcgtcctgtgcc
tttcctcccgaggttctggagtccttagcgctgcgctttgagtctcccgactcccggaac
cgctgggatcgccccttgttcactgtggtgggtttagaagagccattgcccctcgcggag
atccggtctgccttgtttgagaatcgggctcccccgccccatcagtctacgcagtctcag
cctctagcctctggcagctttctgcaccagttggatcaggccacaagccaggtgttgacc
gctgtgatggaagcccagaagagcgctgtgcccggagacttcctaaagctccctggcacc
acggagcccctccgatttacccgacccttgaccttagcagaattgagtcgcctccgtcgc
cagtttatttcctacaccaaaatgcatcccaataacgagaatctgcctcaattggccaac
atgtttcttcagtatctgaaccagagtttgcactaa

DBGET integrated database retrieval system