KEGG   Mus musculus (mouse): 100126774
Entry
100126774         CDS       T01002                                 

Gene name
Esp18, Gm20579
Definition
(RefSeq) exocrine gland secreted peptide 18
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ESP
Other DBs
NCBI-GeneID: 100126774
NCBI-ProteinID: NP_001231692
MGI: 5295686
Ensembl: ENSMUSG00000094024
UniProt: A8R0V1
Position
17 B1; 17 19.22 cM
AA seq 91 aa
MASFPLMFFLIILVYQTILPEGRAVKWTEKEPEISADLKDDFKIPLCQTIRNNIDVCWLS
IGSDKDKPLFLGFIINFEQRWINVLPRIKFN
NT seq 276 nt   +upstreamnt  +downstreamnt
atggcttcattcccactgatgtttttcctcatcattctggtgtatcaaacaatacttcct
gaaggaagggcagtgaaatggactgagaaagaacccgagatatctgctgatctgaaagat
gacttcaaaatacctctttgccaaactataagaaataacatagatgtttgctggttgtca
attggctccgacaaagacaaaccattgtttttaggattcataattaattttgaacaacgt
tggattaatgtactgcctcgaataaagtttaactag

DBGET integrated database retrieval system