KEGG   Mus musculus (mouse): 100201Help
Entry
100201            CDS       T01002                                 

Gene name
Tmem64, 9630015D15Rik, AI790744, AV300874
Definition
(RefSeq) transmembrane protein 64
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-GeneID: 100201
NCBI-ProteinID: NP_852066
MGI: 2140359
Ensembl: ENSMUSG00000043252
Vega: OTTMUSG00000004587
UniProt: Q3U145
Position
4; 4 A2
AA seq 381 aa AA seqDB search
MRNPGGSLPHTLPRALQHAGRTGVVEQPGRWAPERTAGGDRSEDRLPRGGGASAAAAAAA
AAASGALLGAYLERHGLPAASDLPAPAGALAGGPGSGGGVVVGVAEVRNWRCCCLGSTCW
CRSLVLVCVLAALCFASLALVRRYLQHLLLWVESLDSLLGVLLFVVGFIVVSFPCGWGYI
VLNVAAGYLYGFVLGMGLMVVGVLIGTFIAHVVCKRLLTAWVAARIQNSDKLSAVIRVVE
GGSGLKVVALARLTPIPFGLQNAVFSITDVPLPSYLMASSAGLLPTQLLNSYLGTTLRTM
EDVIAEQSLSGYFVFCLQIVISIGLMFYVVHRAQVELNAAIVACEMELKTSLVKGNQSDP
SGSSFYNKRTLTFSGGGINIV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaccccggtgggagcctgccccacacgctgccccgggccttgcagcacgccggt
cggacgggagtcgtggagcagccgggccgctgggcaccggagcggacagcgggaggggac
cgctcggaggaccgccttccccgcgggggcggggccagcgcggcggcggctgctgctgcg
gcggcggcctcgggcgccctgctcggcgcctatctggagcgccacggtctgcccgcggcc
tcggacttgccggcgccggccggggcgttggcaggcggccccgggagcggcggcggcgtg
gtggtcggggtggccgaggtgagaaactggcgctgctgctgcctcggcagcacctgttgg
tgccggagcctcgtgctggtgtgcgtgctggccgccctgtgcttcgcttccctggccctg
gtccgccgctacctgcagcacctcctgctctgggtggagagcctcgactcgctgctcggt
gtcctgctcttcgtcgtgggcttcatcgtggtctccttcccctgcggttggggctacatc
gtgcttaatgtggcggccggctacctgtacggcttcgtgctaggcatggggctcatggtg
gtgggcgtcctcattggcacctttatcgctcatgtggtctgcaagcggctactcaccgcc
tgggtggctgccaggatccagaacagcgacaagctgagcgccgttatccgcgtcgtggag
ggaggaagcggcctgaaggtggtggcgctggcccggctgactcccataccttttgggctt
cagaatgcagtgttttcgattactgacgtccccttgcccagctacctgatggcgtcttca
gctgggctgctcccgactcagcttctgaattcttacttgggaaccacactacggactatg
gaagatgtcatcgcagaacaaagtcttagtggctattttgtcttttgtttacagattgtt
ataagcattggcctcatgttttatgtagtccatcgcgctcaagtggaattgaatgcagct
attgtagcttgtgagatggaactgaaaacctctctggttaaaggcaatcaatcggatccc
agtggctcttccttctacaacaagaggaccctcacgttttctggaggtggaatcaatatt
gtatga

DBGET integrated database retrieval system