KEGG   Mus musculus (house mouse): 100317
Entry
100317            CDS       T01002                                 
Symbol
A730047D20Rik, AAVR, Kiaa0319l
Name
(RefSeq) expressed sequence AU040320
  KO
K24404  dyslexia-associated protein KIAA0319-like protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100317 (A730047D20Rik)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Others
    100317 (A730047D20Rik)
SSDB
Motif
Pfam: PKD_4 Y_Y_Y Big_9 PKD DUF4625 Big_13 He_PIG InlK_D3 GspA_SrpA_N Shisa EGF_2
Other DBs
NCBI-GeneID: 100317
NCBI-ProteinID: NP_598647
MGI: 2140475
Ensembl: ENSMUSG00000028830
Vega: OTTMUSG00000009282
UniProt: Q8K135
Position
4:126647331..126763487
AA seq 1048 aa
MEKRLGVKPSPASWVLPGYCWQTSVKLPRSLYLLYSFFCFSVLWLSTDADESRCQQGKTL
YGAGLRTEGENHLRLLAGSLPFHACRAACCRDSACHALWWLEGMCFQADCSKPQSCQPFR
TDSSNSMLIIFQKSQTTDDLGLLPEDDEPHLLRLGWGRTSWRRQSLLGAPLTLSVPSSHH
QSLLRDRQKRDLSVVPTHGAMQHSKVNHSEEAGALSPTSAEVRKTITVAGSFTSNHTTQT
PEWPKNVSIHPEPSEHSSPVSGTPQVKSTEHSPTDAPLPVAPSYSYATPTPQASSQSTSA
PHPVVKELVVSAGKSVQITLPKNEVQLNAFVLPEAEPGETYTYDWQLITHPTDYSGEVER
KHSQSLQLSKLTPGLYEFKVTVDGQNAHGEGYVNVTVKPEPRKNRPPVAVVSPQFQEISL
PTTSTIIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVD
SDGATNSTTASLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLS
PSSKGKVVEMQGVRTPALQLSAMQEGDYTYQLTVTDTAGQQATAQVTVIVQPENNKPPQA
DAGPDKELTLPVDSTTLDGSKSTDDQRVVSYLWEQSRGPDGVQLENANSSVATVTGLQVG
TYVFTLTVKDERNLQSQSSVNVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDK
GIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVE
VKPDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLLGVLDSDIIVQKIQPYTEQSTKM
LFFVQNDPPHQLFKGHEVAAMLKSELQKQKADFLIFRALEISTVTCQLNCSDHGHCDSFT
KRCVCDPFWMENFIKVQLRDGDSNCEWSVLYVIIASFVIVVALGILSWTTICCCKRQKGK
PKRKSRYKILDATDQESLELKPTSRAGSKQKGPTLSSSLMHSESELDSDDAIFTWPDREK
GKLLYGQNGSVPNGQTPLKSRSAREEIL
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggagaagagactgggagtcaagccaagtcccgcttcctgggttttgccaggatattgt
tggcagacatcagtgaagctgccgagaagcctgtacctgctttacagtttcttctgcttc
agcgttctgtggttgtcaacagatgctgatgagagcagatgccaacaggggaagacactt
tatggagctggcttgagaactgagggagaaaatcacctccggcttcttgcaggaagcctg
cctttccacgcctgtcgggctgcctgctgccgggactctgcctgccacgctctatggtgg
ctggaagggatgtgctttcaggctgactgcagtaagccccagagctgccagccttttagg
acagactcttccaattccatgctgatcatttttcaaaaatcccaaactacagatgatttg
ggccttctgcctgaagatgatgaaccacatcttctgaggctaggctggggcaggacatcg
tggaggaggcagagccttcttggggctcccctcaccctttctgtaccctctagtcaccac
cagagcttactcagggatcggcagaagagagatctcagtgtggtacctacacatggagcg
atgcagcattctaaagtgaatcactcggaggaagcaggtgctctgagtcccacctctgca
gaggtccgcaaaaccattacagttgccggttccttcaccagtaaccacactacacagact
cctgagtggcccaagaatgtgtccatccatcctgaaccatccgagcactccagtcctgta
tctggtactccgcaagtaaaaagcactgagcacagtccaactgatgcccctctgccagtg
gccccctcctacagctatgccacccccacgccccaggcctcttctcagagcacctcagca
ccacacccagttgtaaaggagctggtggtgtctgctgggaagagcgtccagatcaccctg
cctaagaatgaagttcagttaaatgccttcgtccttccagaagcagagccaggagaaacc
tacacctacgactggcagctgatcactcatcctacagactacagtggagaggtggagagg
aaacattcccagagcctccaactgtccaagctgactccaggcctgtacgaattcaaggtg
actgtggatggccagaatgcccatggggaaggctacgtgaatgtgacagtgaaaccagag
ccccgtaagaaccggcctcccgttgctgtggtgtcacctcagttccaggagatctcgctg
ccaaccacttctaccatcattgatggcagccagagcacggatgacgataaaattgtccag
taccactgggaagagcttaaggggcccctgagagaagagaagatctctgaagacacagcc
atactaaaacttagtaagctcgtcccggggaactacaccttcagcttaactgttgtcgac
tctgacggggctaccaactccaccactgcaagcctgactgtgaacaaagctgtggactac
cctcccgtggccaatgcaggccccaaccaagtgatcaccctgcctcagaactccatcacc
ctctttggaaaccagagcacggatgaccacggcatcaccagctatgagtggtcgctcagc
ccgagcagcaaagggaaggtggtggagatgcagggagttagaacgccagccctgcagctg
tccgcaatgcaagaaggagactatacctaccagctcacagtgactgacaccgcaggacaa
caggccaccgcccaagtgactgtgattgtgcagcctgagaacaacaagcctcctcaggca
gatgcaggcccagacaaagagctgaccctgcccgtggacagcacaaccctggacggcagc
aagagcacagatgaccagagagtcgtctcttacctttgggagcagagtcggggacctgac
ggggtgcagctggagaatgccaacagcagtgtcgccactgtgactgggctgcaagtcggg
acttatgtattcaccttgactgtcaaagatgagaggaacctacagagccagagctccgtt
aatgtcattgtcaaagaagaaataaacaaaccgccagtagccaagatcgctgggaacgtg
gtggtgaccttgcccacgagcacagctgagctggatggctcgaggtcctcagatgacaag
gggatagtcagctacctgtggactcgagatgagacgagcccagccgcaggggaggtgctg
aatcactctgaccaccaccctgtcctcttcctctccaacctggtggaggggacctacacg
tttcacctgaaagtgacagatgcaaagggcgagagcgacacagaccggacgacagtggaa
gtgaagcctgaccccaggaaaagcaacctagtggagatcatcttggatgtgaacgtcagt
cagctgactgagaggctgaaggggatgctcatccgccagattggggtcctcctgggggtg
ctggattccgacatcattgtgcaaaagattcagccgtacacggagcagagcaccaagatg
ttgttttttgttcagaacgaccctccccaccagctcttcaaaggccatgaggtggcagcc
atgctcaagagcgagctgcagaagcagaaggctgacttcctcatcttcagagccctggaa
atcagcacagtcacatgtcagctgaactgttctgaccatggccactgtgactcattcacc
aagcgctgtgtctgtgacccgttttggatggagaatttcatcaaggtgcagctgagggat
ggagacagcaactgtgaatggagcgtgctctacgtcatcattgcctcctttgtcattgtt
gttgccttggggatcctgtcatggactacaatctgctgctgcaagaggcaaaaaggaaaa
cccaagaggaaaagcagatacaagatcctggatgccacagatcaggagagcctggagctg
aaaccaacctcccgagcaggcagcaaacagaaaggccccacgctgagcagcagcctgatg
cattctgaatcggagctggacagcgacgatgccatcttcacatggccagaccgggagaag
ggcaaactactgtatggtcagaatggctctgtgccaaacgggcaaacacctttgaagtcc
aggagcgcacgggaggagatcttgtag

DBGET integrated database retrieval system