KEGG   Mus musculus (mouse): 100463512Help
Entry
100463512         CDS       T01002                                 

Gene name
Gm20594, Mtrnr2l
Definition
(RefSeq) predicted gene, 20594
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Humanin
Motif
Other DBs
NCBI-GeneID: 100463512
NCBI-ProteinID: NP_001177661
MGI: 5295700
Ensembl: ENSMUSG00000096887
Vega: OTTMUSG00000057744
UniProt: J3QJY3
Position
6 C3; 6 35.01 cM
AA seq 37 aa AA seqDB search
MAKGGFNCLLFLISEIDLSVKRLKYNNKTRRPLVFCT
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggagggttcaactgtctcttatttttaatcagtgaaattgacctttcagtg
aagaggctgaaatataataataagacgagaagacccttggttttctgtacatag

DBGET integrated database retrieval system