KEGG   Mus musculus (house mouse): 100470
Entry
100470            CDS       T01002                                 
Symbol
Lao1
Name
(RefSeq) L-amino acid oxidase 1
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00270  Cysteine and methionine metabolism
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00360  Phenylalanine metabolism
mmu00380  Tryptophan metabolism
mmu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100470 (Lao1)
   00270 Cysteine and methionine metabolism
    100470 (Lao1)
   00280 Valine, leucine and isoleucine degradation
    100470 (Lao1)
   00350 Tyrosine metabolism
    100470 (Lao1)
   00360 Phenylalanine metabolism
    100470 (Lao1)
   00380 Tryptophan metabolism
    100470 (Lao1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100470 (Lao1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     100470 (Lao1)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 DAO Pyr_redox FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 Thi4 FMO-like MCRA Lycopene_cycl GIDA Pyr_redox_3 NAD_binding_7 Shikimate_DH UDPG_MGDP_dh_N Trp_halogenase IlvN 3HCDH_N ApbA TrkA_N HcgC
Other DBs
NCBI-GeneID: 100470
NCBI-ProteinID: NP_598653
MGI: 2140628
Ensembl: ENSMUSG00000024903
UniProt: B1ARV3
Position
4:118819164..118826107
AA seq 523 aa
MSFRTMAKKSGILVWGILLCVSSCLALYENLVKCFQDPDYEAFLLIAQNGLHTSPLSKRV
VVVGAGMAGLVAAKTLQDAGHEVTILEASNHIGGRVVTLRNKEEGWYLELGPMRIPESHK
LIHTYVQKLGLKLNKFHQYDSNTWYLLNGQRYRASEVMANPGILGYPLRPSEKNKTVTDL
FYQAITKIKPHRKTSNCSQLLSLYDSYSTKAYLMKEGTLSKGAIEMIGDIMNENAGYYKS
LLESLRIASIFSKSDQFSEITGGFDQLPNGLSASLKPGTIRLGSKVERVVRDGPKVKVMY
RTDGPTSALHKLTADYAIITASAKATRLITFQPPLSREKTHALRSVHYTSATKVVLVCNE
RFWEQDGIRGGYSITDRPSRFIYYPSHSLPGGKGVLLASFTVGDDSSFFAALKPNQVVDV
VLDDLAAVHRIPKEELKRMCPKSAIKHWSLDPLTIGAFTEFTPYQFVDYSKQLSQPEGRI
YFAGEHTCLPHSWIDTAIKSGIRASCNIQAAVDKEATRGHTAL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgagtttcaggaccatggccaagaagagtggaatccttgtttgggggatcctgctctgc
gtctccagctgtcttgccctctatgagaaccttgtcaagtgtttccaggatcccgattat
gaggccttccttctcatagcccagaatgggctccatacctccccactgtctaagcgtgtg
gtggtagtgggagctggcatggcaggcctagtggcagctaagaccctacaggatgctggt
cacgaggtaaccatcttggaggccagcaaccacatcggaggtagggtggtcacactcaga
aacaaggaagaaggctggtacttagaacttggaccaatgcgaatcccagaaagccacaag
ctaatccacacctatgtccagaagcttggcctgaaactgaataagttccaccagtatgat
agcaacacctggtacctactcaatggacaacgctatcgtgcctcagaagtcatggctaac
ccaggaatcttgggctaccccctgaggccctcagagaagaacaaaactgtcacagacctg
ttctaccaagccatcactaagatcaaaccacataggaagacatccaactgcagccagctg
ctctccctttatgactcttactccaccaaggcttacctgatgaaggaaggaacgctgagc
aaaggggccatcgagatgatcggggatataatgaatgagaatgctggatactataagtcc
ctcctggagtctctgaggattgcaagcatcttctccaaaagtgaccaattttcagagatc
accggtggctttgaccaactccccaatggcctcagtgctagcctgaagcctggcaccatc
cgtctggggtccaaagtagaaagagtggtgagagacgggcccaaggttaaggttatgtac
cgcacagatgggcccacctctgcactgcacaaactcactgcggattacgccatcatcact
gcctcagccaaggccactcgcctcatcaccttccagccacctctgtcccgagagaaaaca
catgccctgcgctccgttcattacaccagtgccaccaaggtggttttagtgtgcaacgaa
cgcttctgggaacaagatggcatccggggcggctactccatcactgaccgaccctcccgc
ttcatttactatcccagccacagcctgccaggcggcaagggagtcctgctggcctctttc
actgtgggtgatgattcctccttctttgctgccctgaagcccaaccaggtggtcgatgtt
gtgctggatgaccttgcggcagtgcaccgcatacccaaggaggagctaaagcgcatgtgc
ccaaagtcagcgatcaagcactggtctctagaccccctcaccattggcgcctttacagag
ttcacaccctaccaatttgtagactattcgaagcagctctcccagccagagggccgcatc
tactttgctggggagcatacctgcctgccgcacagctggatagacaccgccatcaagtcg
ggcatccgggcctcctgcaacattcaggctgcagtggacaaggaggccactcgaggacat
acggctctttag

DBGET integrated database retrieval system