KEGG   Mus musculus (house mouse): 100494
Entry
100494            CDS       T01002                                 
Symbol
Zfand2a, AA407930, AU016206, Airap
Name
(RefSeq) zinc finger, AN1-type domain 2A
  KO
K24685  AN1-type zinc finger protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    100494 (Zfand2a)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Zinc finger domain-containing proteins
  AN1-type zinc finger domain-containing proteins
   100494 (Zfand2a)
SSDB
Motif
Pfam: zf-AN1 Transp_Tc5_C
Other DBs
NCBI-GeneID: 100494
NCBI-ProteinID: NP_001153380
MGI: 2140729
Ensembl: ENSMUSG00000053581
UniProt: Q9JII7
Position
5:complement(139456971..139470246)
AA seq 171 aa
MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLC
NAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHG
NFCIQHRHPLDHNCQAGSSSASRGRTSTSRAAEQKPSGVSWLAQRLRRTVK
NT seq 516 nt   +upstreamnt  +downstreamnt
atggagtttcctgacttggggaagcactgttcagaaccaacttgcaaacagctagatttt
ctgccaataacatgcgacgcctgtaaacaagatttctgtaaagaccatttttcctacgtg
ggtcataagtgtccctttgcgttcaagaaggatgtgcaggtgcctgtgtgtcctctctgc
aatgcccccatccctgtgaagagaggtgagatcccagatgtggtggtcggcgagcacatg
gacagagattgcacctttcaccctgggaggaacagaaacaaggttttcacacatcgctgc
tccaaagagggatgcaggaagaaggagatgctgcagctggcgtgtgctcagtgccatggc
aacttctgcattcagcacaggcatcctctggaccacaattgccaggctgggagcagctca
gccagcagagggaggacttctacatccagagctgctgagcagaagccatcgggagtcagt
tggctggcccagcggctcaggcgcacagtgaagtga

DBGET integrated database retrieval system