KEGG   Mus musculus (mouse): 100502831
Entry
100502831         CDS       T01002                                 

Symbol
Gm19402
Name
(RefSeq) predicted gene, 19402
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Keratin_B2_2 PMG
Other DBs
NCBI-GeneID: 100502831
NCBI-ProteinID: NP_001191961
MGI: 5011587
Ensembl: ENSMUSG00000095970
UniProt: J3QJV4
Position
10:complement(77525791..77526644)
AA seq 266 aa
MATSTMSVCSSDLSYDRRVCLPGSCDSCTDSSWQVDDCPESCCEPCCCAPSSCQPSCCVP
SCCQSSCCIPSCCQPSCCQSSCCVPSCCAPAPCLTLICTPVSCMSSPCCQSSCCTPSCCQ
QSSCQPACCTCSPCQQPCCMTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPVCCKP
VCCTPICSGSSSSCCQPSCCAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCC
RPTSSVSLLCRPACSRQACCGQKSSC
NT seq 801 nt   +upstreamnt  +downstreamnt
atggccacctccaccatgtctgtctgctccagtgacctaagctatgacaggcgggtctgc
ctgcccggttcctgtgattcttgtactgactcctcctggcaggtggatgactgcccagag
agctgctgtgagccctgctgctgtgcccctagcagctgccagccaagctgctgtgtcccc
agctgctgccagtccagctgctgtatccccagctgctgccagccaagctgctgccagtcc
agctgctgtgtccccagctgctgtgccccagccccctgcctgaccctcatctgcacccca
gtgagctgtatgtccagcccctgctgccaatcttcctgctgcacaccctcatgttgccag
cagtctagctgccagccagcttgctgcacctgctccccctgccagcagccctgctgtatg
accctctgctgcaagcctgtctgctgcacacccatctgctctggaccatgctgccagcag
tctagctgccagtcctcatgctgtcaatccccctgctgtgtgcctgtctgctgcaagcct
gtgtgctgcacacccatctgctctggctcctcctcctcctgctgccagccctcctgctgt
gctcctgtgtgctgcaagccttgctccagcctgtccctgctgtgtcgccctgtgtgcaga
cctgcctgctgtgtgcccacctcctcctgttgtgcctcctcctgccagcccagctgctgc
cgcccaacctccagtgtgtccctgctatgccgccctgcctgctccagacaggcctgctgt
ggacagaagtccagctgctga

DBGET integrated database retrieval system