KEGG   Mus musculus (mouse): 100503388
Entry
100503388         CDS       T01002                                 

Gene name
Gm19668
Definition
(RefSeq) predicted gene, 19668
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Keratin_B2_2 PMG
Other DBs
NCBI-GeneID: 100503388
NCBI-ProteinID: NP_001191963
MGI: 5011853
Ensembl: ENSMUSG00000096380
Vega: OTTMUSG00000049690
UniProt: J3QMD1
Position
10 C1; 10 39.72 cM
AA seq 248 aa
MADTCCTRTCVIAASTTSVCSSNLSCGNRICSPSTCLGASWQADNCQESYCEPPCCAPSC
CQSSYCQPSCCAPAPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQQP
CCVTLCCKPVCCTPICSGSCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICSGSSPCCQPS
CCAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRPACSKQA
CCGQKSSC
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgacacctgctgcacaaggacttgcgtgattgctgcatccaccacatctgtctgc
tccagtaatttgagttgtggcaaccggatatgctctcccagcacctgcctaggtgcctca
tggcaggcagacaattgtcaggagagctactgtgagcccccatgctgtgcccccagctgt
tgccagtccagctactgccagccaagctgctgtgccccagccccctgcctgacccttgtc
tgcaccccagtgagctgtgtgtccagcccctgctgccaatcttcttgctgtacaccctca
tgttgccagcagtctagctgccagccagcttgctgcacctgctccccctgccagcagccc
tgctgtgtgaccctttgctgcaagcctgtctgctgcacacccatctgctctggatcatgc
tgccagcagtctagctgccaatcctcatgctgtcaatccccctgctgtgtgcctgtctgc
tgcaagcctgtgtgctgcacacccatctgctctggctcctccccctgctgccagccctcc
tgctgtgctcctgtgtgctgcaagccctgctccagcctgtccctgctgtgtcgccctgtg
tgcagacctgcctgctgtgtgcccacctcctcctgctgtgcttcctcctgccagcccagc
tgctgtggcccaacctctagtgtatccctgctgtgccgccctgcctgctccaaacaggcc
tgctgtggacagaagtccagctgctga

DBGET integrated database retrieval system