KEGG   Mus musculus (mouse): 100503605Help
Entry
100503605         CDS       T01002                                 

Gene name
Hbb-bs, Beta-s, Hbbt1, Hbbt2
Definition
(RefSeq) hemoglobin, beta adult s chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100503605 (Hbb-bs)
   05143 African trypanosomiasis
    100503605 (Hbb-bs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    100503605 (Hbb-bs)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100503605 (Hbb-bs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin Glycogen_syn Big_8
Motif
Other DBs
NCBI-GeneID: 100503605
NCBI-ProteinID: NP_001188320
MGI: 5474852
Ensembl: ENSMUSG00000052305
Vega: OTTMUSG00000023334
UniProt: P02088 A8DUK4
Structure
PDB: 

Position
7 E3; 7
AA seq 147 aa AA seqDB search
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVAAALAHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgtctctggcctgtggggaaaggtgaac
gccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatgccaaa
gtgaaggcccatggcaagaaagtgataactgcctttaacgatggcctgaatcacttggac
agcctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccccgctgcacaggctgccttccagaaggtggtggctggagtggccgct
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system